Recombinant Mouse Kallikrein-8 (KLK8) Protein (His)

Beta LifeScience SKU/CAT #: BLC-03204P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Mouse Kallikrein-8 (KLK8) Protein (His)

Beta LifeScience SKU/CAT #: BLC-03204P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Mouse Kallikrein-8 (KLK8) Protein (His) is produced by our Yeast expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb Q61955
Target Symbol KLK8
Synonyms Klk8; Nrpn; Prss19Kallikrein-8; mK8; EC 3.4.21.118; Neuropsin; NP; Serine protease 19
Species Mus musculus (Mouse)
Expression System Yeast
Tag N-6His
Target Protein Sequence ILEGRECIPHSQPWQAALFQGERLICGGVLVGDRWVLTAAHCKKQKYSVRLGDHSLQSRDQPEQEIQVAQSIQHPCYNNSNPEDHSHDIMLIRLQNSANLGDKVKPVQLANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCDGMLQGITSWGSDPCGKPEKPGVYTKICRYTTWIKKTMDNRD
Expression Range 33-260aa
Protein Length Full Length of Mature Protein
Mol. Weight 27.1kDa
Research Area Signal Transduction
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Serine protease which is capable of degrading a number of proteins such as casein, fibrinogen, kininogen, fibronectin and collagen type IV. Also cleaves L1CAM in response to increased neural activity. Induces neurite outgrowth and fasciculation of cultured hippocampal neurons. Plays a role in the formation and maturation of orphan and small synaptic boutons in the Schaffer-collateral pathway, regulates Schaffer-collateral long-term potentiation in the hippocampus and is required for memory acquisition and synaptic plasticity. Involved in skin desquamation and keratinocyte proliferation. Plays a role in the secondary phase of pathogenesis following spinal cord injury.
Subcellular Location Secreted. Cytoplasm. Note=Shows a cytoplasmic distribution in the keratinocytes.
Protein Families Peptidase S1 family, Kallikrein subfamily
Database References

KEGG: mmu:259277

STRING: 10090.ENSMUSP00000082588

UniGene: PMID: 22520925

  • Klk8 is involved in the proliferation and migration of keratinocytes through Klk6 in the early stages of wound healing, and possibly in keratinocyte differentiation associated with the upregulation of PAR2 in the late stages of wound healing. PMID: 22358061
  • KLK8 is involved in synaptic tagging during LTP at basal and apical dendritic inputs. PMID: 21646406
  • the serine protease neuropsin is critical for stress-related plasticity in the amygdala by regulating the dynamics of the EphB2-NMDA-receptor interaction, the expression of Fkbp5 and anxiety-like behaviour PMID: 21508957
  • Klk8 might thus be involved in tissue development and rearrangement. PMID: 20180635
  • role of loop structures in the activity of serine protease and regulated secretion PMID: 11854276
  • Neuropsin was localized extracellularly in neuronal cell bodies and their neurites in mouse hippocampus. Neuropsin may be involved in neurite outgrowth during the development of the nervous system. PMID: 11880192
  • gene expression of a serine-protease neuropsin in the mouse vagina, and as a marker of the estrogen-independent persistent proliferation and cornification of the vaginal epithelium PMID: 12354676
  • Neuropsin is the first extracellular protease to show the evident induction of expression and activity by decidualization and might contribute to the remodeling of extracellular components after decidualization. PMID: 12390870
  • mouse MCs store at least two distinct families of tryptic-like proteases in their secretory granules, including PRSS19 PMID: 12646205
  • Presynaptic adhesion molecule L1 is a substrate for neuropsin in the hippocampus. PMID: 12944500
  • study demonstrates changes in the expression of neuropsin and protease M/neurosin in oligodendrocytes following hemisection of the spinal cord PMID: 15378660
  • Neuropsin-/- mice showed attenuated demyelination and delayed oligodendroglial death early during the course of autoimmune encephalomyelitis PMID: 15920728
  • Nrpn is necessary for establishment of LTP and has a significant role in memory acquisition. PMID: 16308352
  • These observations suggest that neuropsin is involved in the secondary phase of the pathogenesis of SCI mediated by demyelination, oligodendrocyte death, and axonal degeneration. PMID: 17629414
  • Neuropsin-dependent late associativity is particularly important in nonstressful associative memory. PMID: 18216192
  • Increased anxiety-like behavior in neuropsin (kallikrein-related peptidase 8) gene-deficient mice. PMID: 18513120
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed