Recombinant Mouse Interleukin-7 (IL7) Protein (His), Active

Beta LifeScience SKU/CAT #: BLC-05314P
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SDS-PAGE.

Recombinant Mouse Interleukin-7 (IL7) Protein (His), Active

Beta LifeScience SKU/CAT #: BLC-05314P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Mouse Interleukin-7 (IL7) Protein (His), Active is produced by our Mammalian cell expression system. This is a full length protein.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The ED50 as determined in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL) is less than 5 ng/ml.
Uniprotkb P10168
Target Symbol IL7
Synonyms Il7; Il-7; Interleukin-7; IL-7
Species Mus musculus (Mouse)
Expression System Mammalian cell
Tag C-6His
Complete Sequence ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI
Expression Range 26-154aa
Protein Length Full Length of Mature Protein
Mol. Weight 15.9 kDa
Research Area Immunology
Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation.
Subcellular Location Secreted.
Protein Families IL-7/IL-9 family
Database References

KEGG: mmu:16196

STRING: 10090.ENSMUSP00000126219

UniGene: PMID: 29505028

  • A key role of the IL7 and Interferon type I receptor axis in the regulation of intratumoral t-cell functions and in the development of primary breast tumor growth and metastasis. PMID: 29070614
  • BMP4 and IL7 appear to be involved in the interaction between intestinal epithelial cells and intestinal epithelial cells and in the mechanism underlying intestinal mucosal barrier dysfunction. PMID: 29436597
  • This finding warrants future development of IL-21 and IL-7 co-expressing whole-cell cancer vaccines and their relevant combinatorial regimens. PMID: 27571893
  • both Flt3 ligand (FL) and IL-7 regulate B-cell commitment in a permissive manner: FL by inducing proliferation of Ly6D(+)CD135(+)CD127(+)CD19(-) progenitors and IL-7 by providing survival signals to these progenitors PMID: 27911806
  • the in vivo biological role of m(6)A modification in T-cell-mediated pathogenesis and reveals a novel mechanism of T cell homeostasis and Il-7 signal-dependent induction of mRNA degradation PMID: 28792938
  • IL-7/IL-7R signaling pathway plays a possible role in recurrent pregnancy loss by upregulating Th17 immunity while downregulating Treg immunity. PMID: 27767237
  • this study shows that IL-7 homeostasis is achieved through consumption by multiple subsets of innate and adaptive immune cells PMID: 28723549
  • lymphatic vessel expansion occurs in two distinct phases; the first wave of expansion is dependent on IL-7; the second phase, responsible for leukocyte exit from the glands, is regulated by lymphotoxin (LT)betaR signaling PMID: 27474071
  • DNM2 mutations cooperate with Lmo2 T-cell oncogenes by enhancing IL-7 signalling. PMID: 27118408
  • IL-7 responsiveness in RTE is designed to maximize survival at the expense of reduced proliferation, consistent with RTE serving as a subpopulation of T cells rich in diversity but not in frequency. PMID: 27129922
  • Expression of IL-7 is beneficial for induction of potent and long-lasting humoral immune responses. PMID: 28100620
  • findings support a redundant role for adaptive Th17 cell- and innate gammadeltaT17 cell-derived IL17 in bacteria-induced colon carcinogenesis, stressing the importance of therapeutically targeting the cytokine itself rather than its cellular sources PMID: 26880802
  • functional Gimap5 is required for optimal signaling through TCR and IL-7R in T cells. PMID: 27023180
  • continuous IL7 signaling was not required for tumor regression, although LIP of naive CD8+ T cells is usually regulated by IL7 PMID: 26880265
  • IL7 represses the follicular helper T cell gene program. PMID: 26743592
  • This study uncovers the metabolic mechanisms by which IL-7 tailors the metabolism of memory T cells to promote their longevity and fast response to rechallenge. PMID: 25957683
  • IL-7 reduced IRAK-M expression and attenuated immune tolerance induced by either LPS or CpGA PMID: 26218271
  • Poly I:C induces IL-7 production, early inflammatory responses, and characteristic pathologies of SS-like dacryoadenitis in non-autoimmune-prone C57BL/6 mice. PMID: 26658504
  • Data show that interleukin 7 (IL-7) signaling is a prerequisite for optimal CD4(+) T cell activation. PMID: 26319414
  • reduced surface expression of IL-7R and concomitant limited responsiveness to IL-7 signals as a common mechanism resulting in reduced cell survival of common lymphoid progenitors and thymocytes at the double-negative to double-positive transition PMID: 26475928
  • Hair follicle expression of IL-7 was required for CD8+ and CD4+ skin-resident memory T (TRM) cells to exert tropism for the epidermis. In a cutaneous T cell lymphoma model, CD4+ TRM lymphoma cell localization depended on hair follicle-derived IL-7. PMID: 26479922
  • Data show the contribution of IL-23/IL-23 receptor and IL-7/IL-7 receptor signaling in Th17 and Th1 cell dynamics during experimental autoimmune encephalomyelitis (EAE). PMID: 26223651
  • IL-7 plays a major role in innate immunity against Citrobacter rodentium infection. PMID: 26034215
  • The effects of 6-formylindolo (3,2-b) carbazole (Ficz), a ligand of aryl hydrocarbon receptor, on IL-7 expression, colitis and lymphocyte phenotypes are reported. PMID: 25799939
  • IL-7 critically acts cooperatively with signaling via the pre-TCR and Notch1 to coordinate proliferation, differentiation and TCRalpha recombination during beta-selection. PMID: 25729925
  • The enhanced thymic reconstitution in the rIL-7/HGFbeta-treated allogeneic BMT recipients results in increased number and functional activities of peripheral T cells. PMID: 24349415
  • these results suggest that PU.1 and Spi-B activate Btk to oppose IL-7 responsiveness in developing B cells. PMID: 25505273
  • Results provided evidence that IL-7/IL-7R induce VEGF-D upregulation and promote lymphangiogenesis via c-Fos/c-Jun pathway in lung cancer. PMID: 24115038
  • OX40 and IL-7 play synergistic, but distinct roles in the homeostatic proliferation of CD4(+) effector memory T cells PMID: 25103720
  • IL-7 holds promise as a critical cytokine for selectively inducing Tfh cell generation. PMID: 24899182
  • NF-kappaB has a role in controlling IL-7 responsiveness of quiescent naive T cells PMID: 24799710
  • IL-12 induces the expression of IL-7 in microglia and macrophages via both IL-12Rbeta2 and IL-12Rbeta1. PMID: 24224652
  • Ikaros is a central regulator of IL-7 signaling and pre-B cell development PMID: 24297995
  • our data point toward an unexpected new role for IL-7 as a potential autocrine mediator of lymphatic drainage PMID: 23963040
  • KGF could up-regulate IL-7 expression through the STAT1/IRF-1, IRF-2 signaling pathway, which is a new insight in potential effects of KGF on the intestinal mucosal immune system. PMID: 23554911
  • -7 enhances the Th1 response to promote the development of Sjogren's syndrome-like autoimmune exocrinopathy in mice. PMID: 23666710
  • IRFs activated by lymphocyte adhesion induce IL-7 transcription through ISRE in stromal cells. PMID: 23376291
  • our results suggest that thymic epithelial cell-derived IL-7 plays a major role in proliferation, survival, and maturation of thymocytes and is indispensable for gammadelta T cell development PMID: 23686483
  • We have analyzed the discrete contributions of the antibody constant (Fc) and IL-7-binding (Fab) domains to the mechanism. PMID: 23610371
  • expression of IL-7/IL-7R is strongly correlated with rheumatoid arthritis activity and ligation of IL-7 to IL-7R contributes to monocyte homing, differentiation of osteoclasts, and vascularization in the collagen-induced arthritis effector phase. PMID: 23606539
  • IL-7 could be an important mediator in arthritic conditions PMID: 22676399
  • Cessation of the IL-7 response of pre-B cell signaling components is controlled via a cell-autonomous mechanism that operates at a discrete developmental transition marked by transient expression of c-Myc. PMID: 23420891
  • Interleukin-7, but not thymic stromal lymphopoietin, plays a key role in the T cell response to influenza A virus. PMID: 23189186
  • Interleukin-7 supports survival of T-cell receptor-beta-expressing CD4(-) CD8(-) double-negative thymocytes. PMID: 23215679
  • poly I:C boosts the T cell immune response in the lung by inducing local IL-7 production, which in turn, enhances T cell-derived IFN-gamma to promote macrophage recruitment, CXCR3 ligand expression, and T cell infiltration. PMID: 23271706
  • Data show that lymphatic endothelial cells (LECs) are a prominent source of IL-7 both in human and murine lymph nodes. PMID: 22955921
  • This is the first demonstration that high levels of IL-7 antagonize Notch-1 signaling and suggest that IL-7 may affect T- versus B-lineage choice in the thymus. PMID: 22899673
  • Although IL-7 is crucial for naive CD4+ T cell homeostatic proliferation in response to lymphopenia, it has minimal impact on the homeostatic proliferation of regulatory CD4+ (Treg) cells. PMID: 22933631
  • These observations establish a key role for IL-7 in the complex mechanisms by which immune mediators modulate metabolic functions. PMID: 22768283
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed