Recombinant Mouse Interleukin-18 (IL18) Protein (His)

Beta LifeScience SKU/CAT #: BLC-05184P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Mouse Interleukin-18 (IL18) Protein (His)

Beta LifeScience SKU/CAT #: BLC-05184P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Mouse Interleukin-18 (IL18) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb P70380
Target Symbol IL18
Synonyms Il18; Igif; Interleukin-18; IL-18; Interferon gamma-inducing factor; IFN-gamma-inducing factor; Interleukin-1 gamma; IL-1 gamma
Species Mus musculus (Mouse)
Expression System E.coli
Tag N-6His
Target Protein Sequence MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
Expression Range 1-192aa
Protein Length Full Length
Mol. Weight 26.1 kDa
Research Area Immunology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function A proinflammatory cytokine primarily involved in polarized T-helper 1 (Th1) cell and natural killer (NK) cell immune responses. Upon binding to IL18R1 and IL18RAP, forms a signaling ternary complex which activates NF-kappa-B, triggering synthesis of inflammatory mediators. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells and natural killer (NK) cells.
Subcellular Location Cytoplasm. Secreted.
Protein Families IL-1 family
Database References

KEGG: mmu:16173

STRING: 10090.ENSMUSP00000137193

UniGene: PMID: 30127003

  • Chimeric antigen receptor T cells releasing IL-18 convert to T-Bet(high) FoxO1(low) effectors that exhibit augmented activity against advanced solid tumors. PMID: 29241547
  • The data suggest that inflammasome signaling is largely protective during murine coronavirus infection, in large part due to the pro-inflammatory effects of IL-18. PMID: 28895072
  • downstream mediator of IL18 receptor activation, phospho-NF-kB, was increased in basolateral amygdala neurons expressing IL18 receptors PMID: 27590137
  • This study provides the first evidence of the ability of IL-18 to induce B-type natriuretic peptide synthesis in vitro and outlines the relationship between the two molecules in acute HF patients with an ongoing inflammatory status. PMID: 24585936
  • Interleukin-18 plays a role in advancing sepsis-induced cardiac dysfunction through inhibition of PP2A activity. PMID: 28526544
  • These observations suggest that IL-18 exerts direct effects upon the GnRH neuron via IL-18Ralpha and acts on GnRH neurons through an autocrine or paracrine pathway. PMID: 28373090
  • Reduced IL-18 serum concentration in children after HUS with no difference in its urine concentration may indicate a loss of the protective effects of this cytokine on renal function due to previously occurred HUS. PMID: 27982687
  • In conclusion, liver X receptor activation inhibits IL-18 production through regulation of its transcription and maturation into an active pro-inflammatory cytokine. PMID: 27149934
  • MyD88 signaling in myeloid and dendritic cells is dispensable for IFN-gamma-dependent control of type A F. tularensis infection. PMID: 28951422
  • study found that IL-18 and IL-1beta are differentially regulated. Despite being constitutively expressed, IL-18 expression was increased and sustained after stimulation of TLRs. In contrast, IL-1beta was induced but not sustained after chronic treatment. PMID: 28468974
  • This provides new insight into the immune phenotype, mechanisms, and signaling pathways that operate in microglial neurotoxic activation in amyotrophic lateral sclerosis. PMID: 28336525
  • the GLA-SE adjuvant operates through interaction with IL-18-producing SCMsmall ef, Cyrillic for the rapid induction of B cell expansion and differentiation, Ab secretion, and Th1 responses PMID: 27794001
  • IL-18 is essentially involved in mediating C. jejuni infection in the gnotobiotic mouse model. PMID: 27322540
  • These results demonstrate a central role for the AIM2 inflammasome in preventing dysbiosis and intestinal inflammation through regulation of the IL-18/IL-22BP/IL-22 and STAT3 pathway PMID: 27524110
  • Aldosterone induced IL-18 gene expression in renal tubular epithelial cells in a concentration- and time-dependent manner. PMID: 27413021
  • this study demonstrated the critical function of IL-18 in lipid metabolism and these findings might contribute to the progress of novel treatments for nonalcoholic fatty liver disease or nonalcoholic steatohepatitis. PMID: 27063959
  • Results indicated that IL-18 has roles apart from those as a proinflammatory cytokine in cardiac myocytes and suggested that IL-18 contributes to the homeostatic maintenance of mitochondrial function and gap-junction turnover in cardiac myocytes, possibly by upregulating autophagy. PMID: 27288439
  • IL-18-elicited NK cell perforin responses seem to be critical for coordinating mucosal inflammation during early infection PMID: 27341123
  • Data indicate that NLRC4 activation in Intestinal epithelial cells (IECs) leads to cell expulsion and IL-18 release, and implicate Caspase-8 in NLRC4 inflammasome responses in vivo by generation of doubly deficient in Caspase-1 and Caspase-8. PMID: 28410991
  • this study shows that IL-18, cooperatively with IL-23, induced prominent inflammation and enhanced psoriasis-like epidermal hyperplasia PMID: 28299442
  • telmisartan can reduce traumatic cerebral edema by inhibiting the NLRP3 inflammasome-regulated IL-1beta and IL-18 accumulation. PMID: 27465336
  • Data, including data from studies in knockout mice, suggest that TNF (tumor necrosis factor), TNFR1 (TNF receptor 1), and IL18 (interleukin 18) are involved in liver lipid metabolism. IL18 or TNFR1 knockout mice on chow show higher liver triglyceride deposition than wild-type mice fed chow; in IL18 or TNFR1 knockout mice, high-refined-carbohydrate diet does not lead to fatty liver disease as it does in wild-type mice. PMID: 27863204
  • GABA-B receptor antagonists reduced Il18 levels in male mice and increased Il18 levels in female mice following neonatal hypoxia ischemia. PMID: 27731803
  • NLRP1 is an innate immune sensor that functions in the context of metabolic stress to produce IL-18, preventing obesity and metabolic syndrome. PMID: 26603191
  • an important role in iNKT cell-mediated experimental eosinophilic esophagitis PMID: 25801352
  • IL-18 is sufficient to protect Birc3-deficient mice from sodium dodecyl sulfate-induced colitis. PMID: 26037070
  • IL-18 plays a facilitative role via NF-kappaB activation in pulmonary hypertension formation. PMID: 26440469
  • IL-18 is a key epithelial-derived cytokine that differentially regulates distinct subsets of intestinal CD4(+) T cells during both homeostatic and inflammatory conditions PMID: 25736457
  • Genetic ablation of IL-18 does not protect mice against maladaptive right ventricular remodeling following exposure to hypobaric hypoxia. PMID: 26747780
  • We conclude that in the systemic lupus erythematosus syndrom IL-18 is involved specifically in the renal pathogenesis PMID: 26465326
  • These results uncover the direct role of IL-18 in promoting goblet cell dysfunction during colitis, leading to breakdown of the mucosal barrier. PMID: 26638073
  • IL-18 is a potent stimulator of Chi3l1 and that Chi3l1 is an important mediator of IL-18-induced inflammatory, fibrotic, alveolar remodeling, and cytotoxic responses. PMID: 25955511
  • macrophages are not involved in IL-18-mediated susceptibility to L. amazonensis. PMID: 26009021
  • The published data prompt to the hypothesis that IL-18 induces a broad spectrum of COPD-like inflammatory and remodeling responses in the murine lung PMID: 25922275
  • Following hypoxic ischemic insult, long term creatine monohydrate supplementation up regulates the IL-6 and IL-18 concentrations triggering the neuroinflammatory and neuroprotective responses. PMID: 26639507
  • High and fluctuating levels of glucose may be associated with inflammation and diabetic atherosclerosis by regulating the expression levels of IL-18. PMID: 25955000
  • a new mechanism by which PKC-beta activation promotes EC dysfunction caused by the de-regulation of the IL-18/IL-18BP pathway, leading to increased VCAM-1 expression, monocyte/macrophage adhesion, and accelerated atherosclerotic plaque formation in diabetes PMID: 25808972
  • PMA treatment during a vulnerable period can alter brain development. IL-18 and IRAK-4 appear to be important for the development of PMA induced injury. PMID: 25918710
  • IL-18 levels modulate innate immune responses and cryptosporidiosis in mice. PMID: 25155632
  • these results indicate that the TLR2/NLRP3/CASP1/IL-18 axis is critical to H. pylori-specific immune regulation. PMID: 26214524
  • This study identifies NCC as an IL18-binding protein that collaborates with IL18r in cell signaling, inflammatory molecule expression, and experimental atherogenesis. PMID: 26099046
  • Neutralization of IL-18 during alveolar hypoxia improves left ventricle diastolic function and partly prevents right ventricle hypertrophy PMID: 25182570
  • This study reveals essential role of autophagy as a negative regulator of lung inflammation and identifies IL-18 as a critical mediator in lung injury due to autophagy deficiency. PMID: 25888640
  • IL-18, but not IL-1beta has a role in aberrant actin depolymerization that triggers the pyrin inflammasome and autoinflammatory disease PMID: 26008898
  • findings show how TLR2 deficiency accelerates IL18-mediated immunosuppression during liver carcinogenesis PMID: 25600646
  • Nlrp3 inflammasome is essential for resistance against P. brasiliensis because it orchestrates robust caspase-1 activation and triggers an IL-18-dependent proinflammatory response. PMID: 25825440
  • IL-18 can positively impact bone marrow lymphopoiesis and T cell development, presumably via interaction with the c-Kit and IL-7 signaling axis. PMID: 25780034
  • Alprostadil treatment can protect renal function by reducing proteinuria. These effects are mediated, at least in part, through down-regulation of Ang-2 and IL-18 expression PMID: 25200363
  • IL-18 was required for the expression of IL-22 in innate lymphoid cells upon Toxoplasma gondii infection. PMID: 25680273

    • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    More from All Products
    Tn5 Transposase
    • Expression system: E.coli;
    CAT#: TN5-BL01
    Sale
    SDS-PAGE analysis of Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein, CAT# BLT-08873P showing >85% purity under 15% SDS-PAGE (Reduced)
    Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein
    • Molecule: SHFL;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+sumo;
    • Sequence: 1-291;
    CAT#: BLT-08873P

    Save $50
    Sale
    SDS-PAGE analysis of Human SFTPA1 (Pulmonary Surfactant-Associated Protein A1) - Recombinant Protein, CAT# BLT-08790P showing >90% purity under 15% SDS-PAGE (Reduced)
    Human SFTPA1 (Pulmonary Surfactant-Associated Protein A1) - Recombinant Protein
    • Molecule: SFTPA1;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 21-248;
    CAT#: BLT-08790P

    Save $50
    Sale
    SDS-PAGE analysis of Human SFTPA2 (Pulmonary Surfactant-Associated Protein A2) - Recombinant Protein, CAT# BLT-08789P showing >90% purity under 15% SDS-PAGE (Reduced)
    Human SFTPA2 (Pulmonary Surfactant-Associated Protein A2) - Recombinant Protein
    • Molecule: SFTPA2;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 21-248;
    CAT#: BLT-08789P

    Save $50
    Sale
    SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein
    • Molecule: NDUFV1;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+SUMO;
    • Sequence: 21-464aa;
    CAT#: BLT-08321P

    Save $50
    Sale
    SDS-PAGE analysis of Human NEU2 (Sialidase-2) - Recombinant Protein, CAT# BLT-08142P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NEU2 (Sialidase-2) - Recombinant Protein
    • Molecule: NEU2;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 1-380aa;
    CAT#: BLT-08142P

    Save $50
    Recently viewed