Recombinant Mouse Interleukin-15 Receptor Subunit Alpha (IL15RA) Protein (hFc), Active
Beta LifeScience
SKU/CAT #: BLC-05313P
Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse Interleukin-15 Receptor Subunit Alpha (IL15RA) Protein (hFc), Active
Beta LifeScience
SKU/CAT #: BLC-05313P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mouse Interleukin-15 Receptor Subunit Alpha (IL15RA) Protein (hFc), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Activity | The ED50 as determined by its ability to block human IL-15-induced proliferation of CTLL-2 mouse cytotoxic T cells is less than 10 ng/ml. |
| Uniprotkb | Q60819 |
| Target Symbol | IL15RA |
| Synonyms | Il15ra; Interleukin-15 receptor subunit alpha; IL-15 receptor subunit alpha; IL-15R-alpha; IL-15RA; CD antigen CD215) [Cleaved into: Soluble interleukin-15 receptor subunit alpha; sIL-15 receptor subunit alpha; sIL-15R-alpha; sIL-15RA)] |
| Species | Mus musculus (Mouse) |
| Expression System | Mammalian cell |
| Tag | C-hFc |
| Complete Sequence | GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTK |
| Expression Range | 33-205aa |
| Protein Length | Partial |
| Mol. Weight | 45.5 kDa |
| Research Area | Immunology |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. In neutrophils, binds and activates kinase SYK in response to IL15 stimulation. In neutrophils, required for IL15-induced phagocytosis in a SYK-dependent manner. |
| Subcellular Location | Membrane; Single-pass type I membrane protein. Nucleus membrane; Single-pass type I membrane protein. Cell surface.; [Soluble interleukin-15 receptor subunit alpha]: Secreted, extracellular space. |
| Database References | KEGG: mmu:16169 STRING: 10090.ENSMUSP00000077878 UniGene: PMID: 28602725 |
