Recombinant Mouse Interleukin-13 (IL13), Active
Beta LifeScience
SKU/CAT #: BLC-05417P

Greater than 95% as determined by SDS-PAGE.
Recombinant Mouse Interleukin-13 (IL13), Active
Beta LifeScience
SKU/CAT #: BLC-05417P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Interleukin-13 (IL13), Active is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
Activity | The ED50 as determined in a cell proliferation assay using TF-1 human erythroleukemic cells is less than 2 ng/ml. |
Uniprotkb | P20109 |
Target Symbol | IL13 |
Synonyms | Il13; Il-13; Interleukin-13; IL-13; T-cell activation protein P600 |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | Tag-Free |
Complete Sequence | PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF |
Expression Range | 22-131aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 12.2 kDa |
Research Area | Immunology |
Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2 |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses. Positively regulates IL31RA expression in macrophages. |
Subcellular Location | Secreted. |
Protein Families | IL-4/IL-13 family |
Database References | KEGG: mmu:16163 STRING: 10090.ENSMUSP00000020650 UniGene: PMID: 29782549 |