Recombinant Mouse Interleukin-10 (IL10), Active

Name: Recombinant Mouse Interleukin-10 (IL10), Active
Brand: Beta LifeScience
SKU: BLC-05309P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Collections: Buy cytokines, chemokines, and growth factors for research online, High-purity interleukins & receptors for research, High-quality cytokines for advanced research, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Interleukin-10 (IL10), Active is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 measured in a cell proliferation assay using FDC-P1 Mouse bone marrow cells is 6 ng/ml.
Uniprotkb	P18893
Target Symbol	IL10
Synonyms	Il10; Il-10Interleukin-10; IL-10; Cytokine synthesis inhibitory factor; CSIF
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	Tag-Free
Complete Sequence	SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS
Expression Range	19-178aa
Protein Length	Full Length of Mature Protein
Mol. Weight	18.9 kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered 4mM HCl.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.

Target Details

Target Function	Major immune regulatory cytokine that acts on many cells of the immune system where it has profound anti-inflammatory functions, limiting excessive tissue disruption caused by inflammation. Mechanistically, IL10 binds to its heterotetrameric receptor comprising IL10RA and IL10RB leading to JAK1 and STAT2-mediated phosphorylation of STAT3. In turn, STAT3 translocates to the nucleus where it drives expression of anti-inflammatory mediators. Targets antigen-presenting cells (APCs) such as macrophages and monocytes and inhibits their release of pro-inflammatory cytokines including granulocyte-macrophage colony-stimulating factor /GM-CSF, granulocyte colony-stimulating factor/G-CSF, IL-1 alpha, IL-1 beta, IL-6, IL-8 and TNF-alpha. Interferes also with antigen presentation by reducing the expression of MHC-class II and co-stimulatory molecules, thereby inhibiting their ability to induce T cell activation. In addition, controls the inflammatory response of macrophages by reprogramming essential metabolic pathways including mTOR signaling.
Subcellular Location	Secreted.
Protein Families	IL-10 family
Database References	KEGG: mmu:16153 STRING: 10090.ENSMUSP00000016673 UniGene: PMID: 30053407 our results provide direct evidence that the capacity of NK cells to secrete IL-10 is required to maintain the successful "innate" modulation of DC phenotype in the gravid uterus. PMID: 28526846 Restrictive IL-10 induction by an innocuous parainfluenza virus vector ameliorates nasal allergy. PMID: 27555458 a regulatory loop in which IL-10 directly restricts CD8(+) T cell activation and function through modification of cell surface glycosylation allowing the establishment of chronic infection. PMID: 29396160 genome-wide knockdown of 19 ribosomal proteins resulted in decreased IL-10 and increased TNF-alpha production. PMID: 29657255 YB-1 orchestrates onset and resolution of renal inflammation via IL-10 gene regulation. PMID: 28664613 this study demonstrates IL-10 production and T cell-suppressive capacity in B cell subsets from atherosclerotic apoE (-/-) mice PMID: 28744806 IL-10 Knock out-Endothelial progenitor cell-Exosomes were highly enriched in microRNAs and proteins that promote inflammation and apoptosis and inhibit angiogenesis. PMID: 28471299 we showed the IL-10 expression of the pyramidal neurons in CA2 and CA3 subregions, for the first time in the world, after infection with the Mu-3 virus PMID: 28493345 These data indicate that CD4(+) follicular regulatory T (Tfr) cells play a multifaceted role in the fine-tuning of the germinal center response and identify IL-10 as an important mediator by which Tfr cells support the germinal center reaction PMID: 29054998 Decreased interleukin-10 (IL-10) expression was found in the hippocampus of the stressed mice, while no differences in pro-inflammatory cytokine expression and tryptophan (TRYP), kynurenine (KYN) or 3-hydroxy kynurenine (3-HK) levels were found. PMID: 28789949 HBV-specific CD8(+) T cells produce IL-10 upon antigen recognition and that this cytokine enhances CD8(+) T cell survival. PMID: 28483675 Novel regulatory T-cells that are induced by B cells and do not express Foxp3 and IL-10 alleviate intestinal inflammation in vivo. PMID: 27581189 Results provide evidence that macrophage IL-10 production is regulated by NLRP3 and contributes to the pathophysiology of doxorubicin-induced cardiotoxicity independently of IL-1beta. PMID: 27225830 Activation of TLR2, TLR4, and TLR9 induced the production of IL-10 in microglia to a greater extent than activation of TLR3. Combination of TLR3 triggering with the other TLRs, enhanced IL-10 through the modulation of its transcription, via interferon (IFN)-beta, but independently of IL-27. Presence of IFN-gamma in the microenvironment abrogated the modulation of IL-10 by TLR3, whereas that of IL-17 had no effect. PMID: 28617991 The absence of IL-10 led to longer illness, more weight loss, more death, and slower viral clearance than in mice that produced IL-10. IL-10 influenced development of disease-causing T cells and entry into the brain of B cells producing antiviral antibody. PMID: 29263262 Cytokine-inducing and anti-inflammatory activity of chitosan and its low-molecular derivative. PMID: 29513410 TonEBP suppresses M2 phenotype via downregulation of the IL-10 in M1 macrophages. PMID: 27160066 Nod2-signaling is essentially involved in the well-balanced innate and adaptive immune responses upon Campylobacter jejuni infection of IL-10(-/-) mice. PMID: 28752081 CD8(+) T cell-derived IL-10 does not contribute significantly to the resolution of contact hypersensitivity responses. PMID: 27714845 Docosahexaenoic acid activates GPR120 to prevent experimental colitis in IL-10 deficient mice. PMID: 28039475 in a Leptospira-infected mouse model, study showed evidence of a possible role of IL-10 on host susceptibility, bacterial clearance and on regulation of cytokine gene expression PMID: 28410507 in vivo IL-10 treatment increased fibroblast activation (proliferation, migration, and collagen production), an effect that was both directly and indirectly influenced by macrophage M2 polarization PMID: 28439731 Suggest that the IL-17A/IL-10/STAT3 signaling pathway plays a crucial role in the pathogenesis of hepatic fibrosis by suppressing hepatocellular autophagy and that blocking this pathway may provide therapeutic benefits for the treatment of hepatic fibrosis. PMID: 28039485 Mechanistic studies suggest a PKC-Syk-mediated signaling pathway, to which IL-10 conversely inhibits, is required for activating macrophage self-targeting, followed by phagocytosis independent of calreticulin Moreover, we identified spleen red pulp to be one specific tissue that provides stimuli constantly activating macrophage phagocytosis albeit lacking in Cd47(-/-) or Sirpalpha(-/-) mice. PMID: 27578867 High IL10 expression is associated with lung cancer. PMID: 26956044 The activation of STAT3 was much higher in Gal12(-/-) macrophages activated by lipopolysaccharide, which was correlated with higher levels of IL-10. Adipocytes showed higher insulin sensitivity when treated with Gal12(-/-) macrophage-conditioned media than those treated with Gal12(+/+) macrophages. PMID: 26873172 this study reveals a key role of IL-10 in controlling cellular metabolism via inhibiting mTORC1, and this metabolic control by IL-10 is critical to control of inflammation. PMID: 28473584 IL-10-MSCs offered superior protection against LPS-induced ALI. PMID: 29072959 methane-rich saline may activate the PI3K-AKT-GSK-3beta pathway to induce IL-10 expression and produce anti-inflammatory effects via the NF-kappaB and MAPK pathways. The findings provide a new pharmacological strategy for management of inflammatory response after acute liver injury. PMID: 28597201 plasma adiponectin and leptin were also decreased in IL 10tm.These findings suggest that frailty observed in this mouse model of chronic inflammation may in part be driven by alterations in fat mass, hormone secretion and energy metabolism PMID: 29267271 We believe that current findings derived from human and mouse experiments will promote the development of new drugs and therapies based on IL-10 modulation, which may enhance host immunity and bacterial clearance during infection. However, because IL-10 can play both favorable and unfavorable effects over the host depending on the bacterial infection, it may act as a double edge sword. PMID: 27522641 IL-12p35 suppresses lymphocyte proliferation, induces expansion of IL-10-expressing and IL-35-expressing B cells and ameliorates autoimmune uveitis. PMID: 28959012 aerobic interval training enhanced the anti-inflammatory indices IL-10/TNF-alpha ratio and IL-15 expression in skeletal muscle in tumor-bearing mice. PMID: 27863332 Both IL-6 protein production and transcript levels were downregulated by RA in respiratory tract epithelial cells (LETs) , but upregulated in macrophages (MACs). RA also increased transcript levels of MCP-1, GMCSF, and IL-10 in MACs, but not in LETs. Conversely, when LETs, but not MACs, were exposed to RA PMID: 27940088 DnaK was able to induce TGF-beta mRNA in treated macrophages in an IL-10 dependent manner. PMID: 27337694 findings suggest that the axis IL-10/claudin-10 is a promising target for the development of therapeutic agents against aggressive melanoma PMID: 29145406 IL-10 signaling in CD11c+ cells controls small intestinal immune homeostasis by limiting reactivation of local memory T cells and to protect against Helicobacter hepaticus-induced colitis. PMID: 27027442 Imperatorin exerts antiallergic effects in Th2-mediated allergic asthma via induction of IL-10-producing regulatory T cells by modulating the function of dendritic cells. PMID: 27185659 Cisplatin induces immune-suppressive tolerogenic dendritic cells in TLR agonist-induced inflammatory conditions via abundant IL-10 production, thereby skewing Th cell differentiation towards Th2 and Tr1 cells. This relationship may provide cancer cells with an opportunity to evade the immune system. PMID: 27172902 Following vasectomy, IL1alpha, IL1beta, IL1ra, IL10, and TNF-alpha may mediate immune reaction in whole epididymis, whereas IL6 and TGF-beta1 may mediate regionally different immune response primarily in the lower part of epididymis. PMID: 27476761 this study shows that progesterone and estradiol inhibit the production of IL-10 by activated B cells PMID: 27317920 Il-10 deficient mice express IFN-gamma mRNA and clear Leptospira interrogans from their kidneys more rapidly than normal C57BL/6 mice PMID: 28237664 Depletion of Tregs increased adaptive T cell responses and deficiency of IL10 reduced morbidity and conferred enhanced protection against influenza virus. PMID: 28086957 Data show that the severity experimental autoimmune encephalomyelitis (EAE) were reduced and the serum IL-10 expression levels were increased in CD226 knockout mice than that in control mice when both received EAE induction. PMID: 26942885 this study shows that Influenza A virus-induced release of IL-10 inhibits the anti-microbial activities of invariant natural killer T cells during invasive pneumococcal superinfection PMID: 27220813 Data show that two functionally distinct cytokines, interleukin-4 (IL-4) and interferon-gamma (IFN-gamma), significantly potentiate the ability of mesenchymal stem cells (MSCs) to inhibit interleukin-10 (IL-10) production by activated regulatory B cells (Bregs). PMID: 27665290 The anti-inflammatory functions of p38 MAPK in macrophages are critically dependent on production of IL-10. PMID: 28877953 Pretreating mice with carrageenan once a day before injecting LPS increased the levels of IL-10 by 2.5-fold and reduced TNF-alpha production by 2-fold compared with control. So, kappa/beta-carrageenan alone and in combination with LPS enhanced the cellular activity and mobility of peritoneal macrophages by increasing cell adhesion and migration compared with control. PMID: 28130856 results demonstrate that IL-10-producing interstitial macrophages negatively regulate Th2- and Th17-mediated inflammatory responses, helping prevent neutrophilic asthma PMID: 26976823

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.