Recombinant Mouse Interleukin-10 (IL10), Active
Beta LifeScience
SKU/CAT #: BLC-05309P
Greater than 95% as determined by SDS-PAGE.
Recombinant Mouse Interleukin-10 (IL10), Active
Beta LifeScience
SKU/CAT #: BLC-05309P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mouse Interleukin-10 (IL10), Active is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Activity | The ED50 measured in a cell proliferation assay using FDC-P1 Mouse bone marrow cells is 6 ng/ml. |
| Uniprotkb | P18893 |
| Target Symbol | IL10 |
| Synonyms | Il10; Il-10Interleukin-10; IL-10; Cytokine synthesis inhibitory factor; CSIF |
| Species | Mus musculus (Mouse) |
| Expression System | E.coli |
| Tag | Tag-Free |
| Complete Sequence | SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS |
| Expression Range | 19-178aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 18.9 kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered 4mM HCl. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Target Details
| Target Function | Major immune regulatory cytokine that acts on many cells of the immune system where it has profound anti-inflammatory functions, limiting excessive tissue disruption caused by inflammation. Mechanistically, IL10 binds to its heterotetrameric receptor comprising IL10RA and IL10RB leading to JAK1 and STAT2-mediated phosphorylation of STAT3. In turn, STAT3 translocates to the nucleus where it drives expression of anti-inflammatory mediators. Targets antigen-presenting cells (APCs) such as macrophages and monocytes and inhibits their release of pro-inflammatory cytokines including granulocyte-macrophage colony-stimulating factor /GM-CSF, granulocyte colony-stimulating factor/G-CSF, IL-1 alpha, IL-1 beta, IL-6, IL-8 and TNF-alpha. Interferes also with antigen presentation by reducing the expression of MHC-class II and co-stimulatory molecules, thereby inhibiting their ability to induce T cell activation. In addition, controls the inflammatory response of macrophages by reprogramming essential metabolic pathways including mTOR signaling. |
| Subcellular Location | Secreted. |
| Protein Families | IL-10 family |
| Database References | KEGG: mmu:16153 STRING: 10090.ENSMUSP00000016673 UniGene: PMID: 30053407 |
