Recombinant Mouse Interleukin-1 Receptor-Like 2 (IL1RL2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09352P
Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse Interleukin-1 Receptor-Like 2 (IL1RL2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09352P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Interleukin-1 Receptor-Like 2 (IL1RL2) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q9ERS7 |
Target Symbol | IL1RL2 |
Synonyms | Il1rl2; Interleukin-1 receptor-like 2; EC 3.2.2.6; IL-36 receptor; Interleukin-1 receptor-related protein 2; IL-1Rrp2; IL1R-rp2 |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | DTCEDIFMHNVIISEGQPFPFNCTYPPETNGAVNLTWYKTPSKSPVSNNRHLRVHQDQTWILFLPLTLEDSGIYQCVIRNAHNCYQIAVNLTVLKNHWCDSSMEGSPVNSPDVYQQILPIGKSGSLNCHLYFPESCALDSIKWYKGCEEIKAGKKYSPSGAKLLVNNVAVEDGGSYACSARLTHLGRHFTIRNYIAVNTKEVEYGRRIPNITYPKNNSIEVPLGSTLIVNCNITDTKENTNLRCWRVNNTLVDDYYKDSKRIQEGIETNVSLRDQIRYTVNITFLKVKMEDYGRPFTCHAGVSAAYIILIYPVPDFR |
Expression Range | 22-338aa |
Protein Length | Partial |
Mol. Weight | 40.0kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Receptor for interleukin-36 (IL36A, IL36B and IL36G). After binding to interleukin-36 associates with the coreceptor IL1RAP to form the interleukin-36 receptor complex which mediates interleukin-36-dependent activation of NF-kappa-B, MAPK and other pathways. The IL-36 signaling system is thought to be present in epithelial barriers and to take part in local inflammatory response; it is similar to the IL-1 system. Seems to be involved in skin inflammatory response by induction of the IL-23/IL-17/IL-22 pathway. |
Subcellular Location | Membrane; Single-pass type I membrane protein. |
Protein Families | Interleukin-1 receptor family |
Database References | |
Tissue Specificity | Expressed in bone marrow-derived dendritic cells, splenic CD4(+) T-cells, bone marrow-derived macrophages and bone marrow-derived neutrophils. |
Gene Functions References
- IL-36R likely contributes to acute kidney injury pathogenesis through NF-kB activity and IL-6 and TNF-a upregulation. PMID: 29241623
- these findings reveal a fundamental contribution for the IL-36/IL-36R axis in regulating the Treg-Th9 cell balance with broad implications for Th cell-mediated disorders, such as inflammatory bowel diseases and particularly ulcerative colitis PMID: 28327619
- IL-36R-deficient mice were protected from influenza virus-induced lung injury and mortality PMID: 27966554
- Data show that Interleukin-36 receptor (IL-36R)-deficient fibroblast-like synoviocytes (FLS) had a limited capacity to support plasma cells (PC) survival compared to wild-type FLS. PMID: 28857172