Recombinant Mouse Interferon Regulatory Factor 8 (IRF8) Protein (His-SUMO)

Name: Recombinant Mouse Interferon Regulatory Factor 8 (IRF8) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-10827P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Interferon Regulatory Factor 8 (IRF8) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P23611
Target Symbol	IRF8
Synonyms	Irf8; Icsbp; Icsbp1; Interferon regulatory factor 8; IRF-8; Interferon consensus sequence-binding protein; ICSBP
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	MCDRNGGRRLRQWLIEQIDSSMYPGLIWENDEKTMFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGVAPAGCMSEVPEMECGRSEIEELIKEPSVDEYMGMTKRSPSPPEACRSQILPDWWVQQPSAGLPLVTGYAAYDTHHSAFSQMVISFYYGGKLVGQATTTCLEGCRLSLSQPGLPKLYGPDGLEPVCFPTADTIPSERQRQVTRKLFGHLERGVLLHSNRKGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTNQFIRELQQFYATQSRLPDSRVVLCFGEEFPDTVPLRSKLILVQVEQLYARQLVEEAGKSCGAGSLMPALEEPQPDQAFRMFPDICTSHQRPFFRENQQITV
Expression Range	1-424aa
Protein Length	Full Length
Mol. Weight	64.2kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Transcription factor that specifically binds to the upstream regulatory region of type I interferon (IFN) and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)). Can both act as a transcriptional activator or repressor. Plays a negative regulatory role in cells of the immune system. Involved in CD8(+) dendritic cell differentiation by forming a complex with the BATF-JUNB heterodimer in immune cells, leading to recognition of AICE sequence (5'-TGAnTCA/GAAA-3'), an immune-specific regulatory element, followed by cooperative binding of BATF and IRF8 and activation of genes. Required for the development of plasmacytoid dendritic cells (pDCs), which produce most of the type I IFN in response to viral infection. Positively regulates macroautophagy in dendritic cells.
Subcellular Location	Nucleus. Cytoplasm.
Protein Families	IRF family
Database References	KEGG: mmu:15900 STRING: 10090.ENSMUSP00000040245 UniGene: PMID: 29593283 Study shows that IRF8 is required for Th9 differentiation in vitro and in vivo. IRF8 functions through a transcription factor complex consisting of IRF8, IRF4, PU.1 and BATF, which binds to DNA and boosts Il9 transcription. PMID: 29233972 Expression of IRF-8 is significantly elevated in the microglia of AD mice. Silencing of IRF-8 abolished Abeta1-40-induced microglia activation. PMID: 28856571 DNA methylation plays a protective role in cisplatin-induced acute kidney injury by regulating specific genes, such as Irf8. PMID: 28709638 IRF8 does not play an essential intrinsic role in Th17 cell differentiation. PMID: 27140932 frequencies of antigen-experienced CD4+CD11ahiCD49dhi cells that were CD44hiCD62L- were similar in MLN of infected Irf8-/- and B6 mice, but the proportions of CD4+GATA3+ and CD4+IL-4+ T cells were lower in infected Irf8-/- mice PMID: 28968468 Mysm1 enhanced function of the IRF2 and IRF8 promoters, suggesting that Mysm1 governs the IRFs for hematopoietic stem cell homeostasis. PMID: 27277682 results show that polymorphonuclear-myeloid-derived suppressor cells arise from a newly defined granulocyte progenitors (GP) stage within the bone marrow and that IRF8 levels (and/or their downstream target genes) in those GPs guide their expansion or contraction PMID: 28356386 IRF8 differentially controls the survival. PMID: 27637148 IRF8 might play a role in restraining excess lymphocyte proliferation. PMID: 27171004 IRF8 controls Th1 immune response in Treg cells independent of T-bet. PMID: 26166768 The authors further identified a distinct molecular signature of F4/80(hi) and CD11b(hi) macrophages and found that Irf8 was vital for macrophage maturation. PMID: 27412700 this study shows that myeloid-specific SIRT1 restrains pro-inflammatory processes by deacetylating IRF8 PMID: 28008797 IRF8 was a target of miR-451a in vitro and in vivo. The data indicate the function and a target of miR-451a in SLE PMID: 28120198 the mechanism for the observed differential induction of the mouse Ifit1, Ifit2, and Ifit3 genes in B cells and demonstrated that the repressive effect of the transcription factor interferon regulatory factor 8 (IRF8), which is highly expressed in B cells, played an essential role in this regulation. PMID: 27137933 direct the expression of a set of genes, the IRF8/IRF1 regulome, that play critical roles in host inflammatory and antimicrobial defenses in mouse models of neuroinflammation and of pulmonary tuberculosis, respectively PMID: 27001747 we identified IRF8 target genes in gastric epithelial cells, providing a detailed understanding of how IRF8 functions in gastric mucosal innate immunity PMID: 26843324 results suggest that impaired Icsbp expression enhances leukemogenesis by deregulating processes that normally limit granulocyte expansion during the innate immune response. PMID: 26683374 variation in IRF4 or IRF8 levels resulting from genetic polymorphisms or environmental cues will govern tissue dendritic cells numbers and regulate the magnitude of their functional responses. PMID: 26746189 It plays a crucial role in the transformation of microglia to a reactive state by regulating the expression of various genes. PMID: 26318672 Data indicate that interferon regulatory factor-8 (IRF8) regulates tumor behavior in an matrix metalloproteinase 3 (MMP3)-dependent manner. PMID: 26008967 Data indicate that interferon regulatory factors IRF4 and IRF8 control distinct activated B cell states. PMID: 26437243 dendritic cells from mice with CD11c-specific constitutive b-catenin activation upregulated IRF8 through targeting of the Irf8 promoter, leading to in vivo expansion of IRF8-dependent CD8alpha+, plasmacytoid, and CD103+ CD11b2 dendritic cells. PMID: 25416805 Loss of IRF8 in T Cells Exacerbates Uveitis, Whereas Irf8 Deletion in the Retina Confers Protection PMID: 26163590 Data show that IRF8 directly interacts with NFATc1 to prevent NFATc1 translocation and thus inhibits the hypertrophic response. PMID: 24526256 we concluded that the IRF-8 KO cells performed pure uncorrelated random walks, while WT splenocytes were able to make singular drifted random walks that collapsed on a straight ballistic motion for the system as a whole PMID: 25322144 IRF5 expression in microglia is regulated by IRF8. IRF5 directly upregulates P2rX4 expression on microglia in peripheral nerve injury, and may play a role in neuropathic pain. PMID: 24818655 Data indicte that interferon regulatory factor 8 (IRF8) expression becomes dependent on transcription factor Batf3. PMID: 26054719 These data highlight a critical role for IRF8 in inflammatory monocyte differentiation and migration during WNV infection. PMID: 25277331 IRF8 is a major autophagy regulator in macrophages, essential for macrophage maturation, survival and innate immune responses PMID: 25775030 plays a key role in the cross-talk between melanoma and immune cells delimiting tumor spread PMID: 24597645 Irf8-knockout microglia exhibited a differential expression pattern of nucleotide-degrading enzymes compared to their wild-type counterparts. PMID: 24798612 Basal IRF8-PU.1 binding maintained the expression of a broad panel of genes essential for macrophage functions (such as microbial recognition and response to purines) and contributed to basal expression of many LPS-inducible genes PMID: 25637355 we demonstrate that interferon regulatory factor-8 regulates basophil and mast cell development PMID: 25398936 The transcription factors IRF8 and PU.1 negatively regulate plasma cell differentiation. PMID: 25288399 The overexpressed IRF8 can effectively inhibit the differentiation of RAW264.7 cells into osteoclast-like cells. PMID: 24606735 we found that the transcriptional factor IRF8 plays a protective role in the cerebral ischaemic-reperfusion injury by attenuating neuronal apoptosis PMID: 24528256 IRF8 enhanced alphavbeta8 integrin expression in APCs and activated TGF-beta signaling leading to T helper 17 (Th17) cell differentiation PMID: 24485804 Data indicate that interferon regulatory factor 8 (IRF8) inhibited smooth muscle cells (SMCs) marker gene expression through regulating serum response factor (SRF) transactivation in a myocardin-dependent manner. PMID: 24248596 Data from mutant/knockout mice suggest that Irf8 is involved in innate immunity against Plasmodium berghei cerebral malaria; neuronal gene expression up-regulated by Plasmodium berghei infection favors proteins with IRF8 binding sites. PMID: 23853600 IRF-8 is an essential factor for the maintenance of proper immune cell recruitment in granulomas. PMID: 23717393 IRF8-deficient mice produced anti-dsDNA Abs. In a double-transgenic model, B cell anergy was breached in IRF8-deficient mice. Anergic B cells in the IRF8-deficient background were able to mature further & regain responses to Ag stimulation. PMID: 24218455 Irf8 expression in DC9 cells led to an increase in Id2 & Batf3 transcript levels. Without it, Id2 & Batf3 expression was insufficient for directing classical CD8alpha(+) DC development. PMID: 24227775 IRF8-rescued BCR-ABL-expressing dendritic cells were capable of inducing CTLs more efficiently than control dendritic cells. IRF8 is an attractive target in next-generation therapies for chronic myelogenous leukemia. PMID: 24242069 These results suggest a central role for IFN regulatory factor 8-expressing CD8(+) DCs in governing the TLR11- and TLR12-mediated host defense against Toxoplasma gondii. PMID: 24078692 Irf8 Expression Is Required for Transcriptional Identity of Early DC Progenitors. PMID: 23623495 Irf8-deficient mice generate myeloid populations highly homologous to tumor-induced myeloid-derived suppressor cells. PMID: 24091328 MiR-22 binds directly to the 3'UTR of the mouse Irf8 mRNA. PMID: 23251709 Data indicate that Bcr-abl increases PTPN13 promoter activity in an Icsbp-dependent manner. PMID: 22891763 these results underscore a key role of IRF-8 in the cross talk between melanoma and immune cells, thus revealing its critical function within the tumor microenvironment in regulating melanoma progression and invasiveness. PMID: 23308054

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.