Recombinant Mouse Interferon Epsilon (IFNE) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10397P
Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse Interferon Epsilon (IFNE) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10397P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mouse Interferon Epsilon (IFNE) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q80ZF2 |
| Target Symbol | IFNE |
| Synonyms | Ifne; Ifne1; Ifnt1Interferon epsilon; IFN-epsilon; Interferon epsilon-1; Interferon tau-1 |
| Species | Mus musculus (Mouse) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | LEPKRIPFQLWMNRESLQLLKPLPSSSVQQCLAHRKNFLLPQQPVSPHQYQEGQVLAVVHEILQQIFTLLQTHGTMGIWEENHIEKVLAALHRQLEYVESLGGLNAAQKSGGSSAQNLRLQIKAYFRRIHDYLENQRYSSCAWIIVQTEIHRCMFFVFRFTTWLSRQDPDP |
| Expression Range | 22-192aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 36.0kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Type I interferon required for maintaining basal levels of IFN-regulated genes, including 2'-5'-oligoadenylate synthetase, IRF7 and ISG15, in the female reproductive tract. Directly mediates protection against viral, including HSV-2, and bacterial, including Chlamydia muridarum, genital infections. |
| Subcellular Location | Secreted. |
| Protein Families | Alpha/beta interferon family |
| Database References | KEGG: mmu:230405 STRING: 10090.ENSMUSP00000059199 UniGene: PMID: 23951133 |
