Recombinant Mouse Interferon-Activable Protein 204 (IFI204) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-07222P
Greater than 85% as determined by SDS-PAGE.
Recombinant Mouse Interferon-Activable Protein 204 (IFI204) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-07222P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mouse Interferon-Activable Protein 204 (IFI204) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P0DOV2 |
| Target Symbol | IFI204 |
| Species | Mus musculus (Mouse) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | QNIPRGAVLHSEPLTVMVLTATDPFEYESPEHEVKNMLHATVATVSQYFHVKVFNINLKEKFTKKNFIIISNYFESKGILEINETSSVLEAAPDQMIEVPNSIIRNANASPKICDIQKGTSGAVFYGVFTLHKKTVNRKNTIYEIKDGSGSIEVVGSGKWHNINCKEGDKLHLFCFHLKTIDRQPKLVCGEHSFIKISKRGN |
| Expression Range | 216-417aa |
| Protein Length | Partial |
| Mol. Weight | 28.7 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Interferon-stimulated protein that plays a role in several biological processes including cell differentiation, autophagy and innate immunity. Cooperates with CGAS to sense dsDNA and activates the STING-dependent type I IFN pathway. Mechanistically, gets acteylated upon bacterial infection and then translocates from nucleus into cytoplasm to recruit STING for activation of TBK1-dependent IRF3 nuclear translocation and IFN-beta release. Inhibits the transcription of ribosomal RNA. May inhibit DNA binding by UBTF. Inhibits cell growth via p53/TP53 and RB1-dependent and independent pathways. Acts as a coactivator of RUNX2 during osteogenesis. May be involved in macrophage differentiation. Enables skeletal muscle and cardiac myocyte differentiation by sequestring Id proteins in the cytosol and promoting their ubiquitination and subsequent degradation. |
| Subcellular Location | Nucleus. Nucleus, nucleolus. Cytoplasm. |
| Protein Families | HIN-200 family |
| Database References | KEGG: mmu:15951 UniGene: PMID: 29472103 |
