Recombinant Mouse Hyaluronan Synthase 2 (HAS2) Protein (His-SUMO)

Name: Recombinant Mouse Hyaluronan Synthase 2 (HAS2) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-03494P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Hyaluronan Synthase 2 (HAS2) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P70312
Target Symbol	HAS2
Synonyms	Has2; Hyaluronan synthase 2; EC 2.4.1.212; Hyaluronate synthase 2; Hyaluronic acid synthase 2; HA synthase 2
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	EHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSDDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETEESHKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWYNQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFREWLYNAMWFHKHHL
Expression Range	67-374aa
Protein Length	Partial
Mol. Weight	51.9kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. Therefore, it is essential to hyaluronan synthesis a major component of most extracellular matrices that has a structural role in tissues architectures and regulates cell adhesion, migration and differentiation. This is one of the isozymes catalyzing that reaction and it is particularly responsible for the synthesis of high molecular mass hyaluronan. Required for the transition of endocardial cushion cells into mesenchymal cells, a process crucial for heart development. May also play a role in vasculogenesis. High molecular mass hyaluronan also play a role in early contact inhibition a process which stops cell growth when cells come into contact with each other or the extracellular matrix.
Subcellular Location	Membrane; Multi-pass membrane protein.
Protein Families	NodC/HAS family
Database References	KEGG: mmu:15117 STRING: 10090.ENSMUSP00000062212 UniGene: PMID: 28787175 Expression of the innate immune receptor Toll-like receptor 4 (TLR4) and the extracellular matrix glycosaminoglycan hyaluronan (HA) on type 2 alveolar epithelial cells ( PMID: 27694932 Has2 mRNA was expressed in the surrounding mesenchyme from E12.0 to 18.0 in both molar and incisor tooth germs, but disappeared after birth. PMID: 27289075 the ineffective repair of injured cartilage in Has1(-/-) joints can be at least partly explained by the markedly enhanced expression of particular genes in pathways linked to ECM turnover, IL-17/IL-6 cytokine signaling, and apoptosis. PMID: 26521733 these results highlight the role of nSMase2 in apoptosis evoked by nutrient starvation that could contribute to the delayed apoptosis of hypertrophic chondrocytes in the growth plate, and emphasize the antiapoptotic properties of HAS2 PMID: 25555205 mir-23a-3p causes cellular senescence by targeting hyaluronan synthase 2: possible implication for skin aging. PMID: 25264594 Has2 expression and hyaluronan produced at the tips of epithelial cells play a critical role in driving tubulogenesis and branching in vitro. PMID: 25163516 Hyaluronan synthase 2 has a role in protecting skin fibroblasts against apoptosis induced by environmental stress PMID: 25266724 Stimulation with LPS caused rapid increases in versican mRNA and protein, a rapid increase in Has1 mRNA, and concomitant inhibition of hyaluronidases 1 and 2, the major hyaluronan degrading enzymes PMID: 24472738 This study demonistrated that Has2 expression in adult mouse subventricular zone and rostral migratory stream and in ischemic cortex. PMID: 23391595 This study identifies Has2 as a novel downstream target of Shh signaling required for joint patterning and chondrogenesis. PMID: 23313125 HAS2 was significantly upregulated at the level of gene expression during muscle hypertrophy. PMID: 22785117 NSMase2/Cer are the key mediators of the regulation of HA synthesis, via microdomains and the Akt/mTOR pathway PMID: 22383528 Inhibition of Has2 expression and extracellular hyaluronic acid production requires MiR23 in the embryonic heart to restrict endocardial cushion formation. PMID: 21778427 Data show that Has2 knockout mice died near birth and displayed severe abnormality in skeletal development. PMID: 21224752 PDGF-BB stimulates cultured cardiomyocytes to synthesize the extracellular matrix component hyaluronan via HAS2 PMID: 21200430 Data suggest that hyaluronan production by Has2 in chondrocytes is not only essential for formation of an organized growth plate and subsequent long bone growth but also for normal modeling of the diaphyseal bone. PMID: 21246657 hyaluronan synthase 2 activity is regulated by dimerization and ubiquitination PMID: 20507985 Expression of the mouse HAS2 gene in Drosophila tissues by the Gal4/UAS system resulted in massive HA accumulation in the extracellular space,supporting the idea that in vivo HA biosynthesis does not require molecules other than the HAS protein PMID: 14966127 Has2 expression was impaired in oocyte-cumulus cell complexes in knockout mice. PMID: 15531364 strongly, albeit transiently, expressed in numerous embryonic tissues PMID: 15765504 natural antisense mRNAs of HAS2 may have an important and novel regulatory role in the control of HAS2, hyaluronan biosynthesis, and HA-dependent cell functions PMID: 15843373 Has2 deficiency illustrates the crucial role of hyaluronan in skeletal growth, patterning, chondrocyte maturation and synovial joint formation in the developing limb. PMID: 19633173 Tbx2, a central intermediary of Bmp-Smad signaling, has a central part in directing Has2 and Tgfbeta2 expression, facilitating endocardial cushions formation. PMID: 19846762

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.