Recombinant Mouse Homeobox Protein Otx2 (OTX2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-11213P
Greater than 85% as determined by SDS-PAGE.
Recombinant Mouse Homeobox Protein Otx2 (OTX2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-11213P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mouse Homeobox Protein Otx2 (OTX2) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P80206 |
| Target Symbol | OTX2 |
| Synonyms | Otx2; Otx-2; Homeobox protein OTX2; Orthodenticle homolog 2 |
| Species | Mus musculus (Mouse) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKSSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL |
| Expression Range | 1-289aa |
| Protein Length | Full Length |
| Mol. Weight | 37.6 kDa |
| Research Area | Developmental Biology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Transcription factor probably involved in the development of the brain and the sense organs. Can bind to the bicoid/BCD target sequence (BTS): 5'-TCTAATCCC-3'. |
| Subcellular Location | Nucleus. |
| Protein Families | Paired homeobox family, Bicoid subfamily |
| Database References | STRING: 10090.ENSMUSP00000113690 UniGene: Mm.134516 |
| Tissue Specificity | Brain: restricted regions of the developing rostral brain including the presumptive cerebral cortex and olfactory bulbs; expressed in the developing olfactory, auricolar and ocular systems, including the covering of the optic nerve. |
