Recombinant Mouse Homeobox Protein Nkx-2.2 (NKX2-2) Protein (His-SUMO)

Name: Recombinant Mouse Homeobox Protein Nkx-2.2 (NKX2-2) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-09251P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Mouse Homeobox Protein Nkx-2.2 (NKX2-2) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P42586
Target Symbol	NKX2-2
Synonyms	Nkx2-2; Nkx-2.2; Nkx2b; Homeobox protein Nkx-2.2; Homeobox protein NK-2 homolog B
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	MSLTNTKTGFSVKDILDLPDTNDEDGSVAEGPEEESEGPEPAKRAGPLGQGALDAVQSLPLKSPFYDSSDNPYTRWLASTEGLQYSLHGLAASAPPQDSSSKSPEPSADESPDNDKETQGGGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVAVPVLVRDGKPCHALKAQDLAAATFQAGIPFSAYSAQSLQHMQYNAQYSSASTPQYPTAHPLVQAQQWTW
Expression Range	1-273aa
Protein Length	Full Length
Mol. Weight	46.1kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Transcriptional activator involved in the development of insulin-producting beta cells in the endocrine pancreas. May also be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance. Binds to elements within the NEUROD1 promoter.
Subcellular Location	Nucleus.
Protein Families	NK-2 homeobox family
Database References	KEGG: mmu:18088 STRING: 10090.ENSMUSP00000069666 UniGene: Mm.330639
Tissue Specificity	Expressed in restricted areas of the developing CNS: the hindbrain and forebrain, and pancreas.

Gene Functions References

The transient hypoxia at P7 altered the expression of Nkx2.2, resulting in delayed myelination in the external capsule. PMID: 28546087
This suggests that Nkx2.2 is not only required in the early pancreatic progenitors, but has additional essential activities within the endocrine progenitor population. PMID: 28071588
Lmx1a is expressed in enterochromaffin cells and functions downstream of Nkx2.2. PMID: 27287799
nuclear import of Nkx2-2 is mediated not only by the classical import pathway but also directly by imp beta1 or imp 13 PMID: 27956177
Demonstrate that a rare mature enteroendocrine cell subpopulation that is demarcated by Nkx2.2 expression display stem cell properties during normal intestinal epithelial homeostasis, but is not easily activated upon injury. PMID: 26492922
that Nkx2.2 and Nkx2.9 proteins play no role in the development of branchiovisceral motor neurons in hindbrain rostral to rhombomere 4. PMID: 25919494
These data identify Nkx2.2 as key regulator to determine neuronal subtypes in the p3 domain of the central nervous system. PMID: 25840610
The study demonstrates a previously unrecognized mechanism that controls insulin expression through c-Abl-regulated NKx2.2 and GLUT2. PMID: 24835010
Our studies reveal that a subset of mouse perineurial cells are CNS-derived, express Nkx2.2, and are essential for motor nerve development. PMID: 24979729
NKX2-2 and MNX1 are etiological genes for neonatal diabetes. PMID: 24411943
Nato3 induces ectopic Foxa2-positive cells and indirectly downregulates Nkx2.2 expression. PMID: 24401371
Nkx2.2 functions as a major 'switch' to turn off Pdgfra signaling in oligodendrocyte precursor cells and initiate the intrinsic program for oligodendrocyte differentiation. PMID: 24449836
Sirt2 enhances CG4 oligodendroglial differentiation and report a novel mechanism through which Nkx2.2 represses CG4 oligodendroglial differentiation via Sirt2. PMID: 21669943
The NKX2-2 can induce desired neuronal lineages from most expressing neural progenitor cells by a mechanism resembling developmental binary cell-fate switching. PMID: 21624811
Nkx2.2 acts by reinforcing the transcriptional networks initiated by Pax4 and Arx in early committed beta- and alpha-cell, respectively. PMID: 21880149
Mutation of the endogenous Nkx2.2 tinman (TN) domain in mice abolishes the interaction between Nkx2.2 and Grg3 and disrupts beta-cell specification PMID: 22056672
these experiments identify novel genetic interactions between Nkx2.2 and Arx within the endocrine progenitor cells that ensure the correct specification and regulation of endocrine hormone-producing cells PMID: 21856296
sonic hedgehog-GLI1 downstream target genes PTCH1, Cyclin D2, Plakoglobin, PAX6 and NKX2.2 are differently regulated in medulloblastoma and astrocytoma PMID: 21059263
Data argue that the Nkx2.2 and Nkx2.9 transcription factors contribute crucially to the formation of neuronal networks that function as central pattern generators for locomotor activity in the spinal cord. PMID: 21068056
Nkx2.2 can bind to ghrelin promoter;results suggest upregulation of ghrelin in Nkx2.2 null mice is not due to loss of repression of ghrelin promoter in nonghrelin islet cells; Nkx2.2 may contribute to activation of ghrelin in mature islet epsilon-cells PMID: 19965928
co-expression of Nkx2.2 and Nkx6.2 transcription factors in myelinating oligodendrocytes suggests their functional interactions in the regulation of myelin sheath formation and/or maintenance PMID: 19780200
Expression profiling of Nkx2.2-/- mice during embryogenesis has allowed identification of known and novel pancreatic genes that function downstream of Nkx2.2 to regulate pancreas development. PMID: 20003319
regulates expression of genes selectively expressed in islet beta cells PMID: 12426319
role of Pax4 appears to be accomplished via its genetic interaction with another homeobox gene, Nkx2.2 PMID: 14729487
Nkx2.2 and Pax4 are required to specify or maintain differentiation of the beta cell fate. PMID: 14970313
Data show that FoxA2, Nkx2.2, and PDX-1 regulate islet beta-cell-specific mafA expression through conserved sequences located between base pairs -8118 and -7750 upstream from the transcription start site. PMID: 16847327
The control of oligodendrocyte differentiation by Olig2, Sox10 and Nkx2.2 is a dosage-dependent developmental process and can be affected by both haploinsufficiency and over-dosage. PMID: 17098222
Nkx2.2 functions predominantly as a transcriptional repressor during specification of endocrine cell types in the pancreas. PMID: 17202186
indicate a previously undiscovered role for Nkx2.2 in the maintenance of mature beta-cell function and the formation of normal islet structure PMID: 17456846
These studies identify a novel role for Nkx2.2 in intestinal endocrine cell development and reveal the regulatory similarities between cell type specification in the pancreatic islet and in the enteroendocrine population of the intestine. PMID: 18022152
During development, Phox2b and Nkx2.2 form a non-cell-autonomous feedback loop that links the neural crest with the pancreatic epithelium, and regulates the size of the beta-cell population. PMID: 18506029
These results together imply that Nkx2.2 antisense RNA has a certain biological function which is likely to be not only based on the affect on transcription level of Nkx2.2 coding gene in cis, but also on the other mechanisms. PMID: 18538132
NKX2.2 functions in immature endocrine cells to control neuroendocrine differentiation in normal intestine and is expressed in most neuroendocrine tumors of the gut PMID: 18987169
These data provide important insights into specific functions of PAX6 and NKX2.2 during glial cell specification that have so far remained largely unexplored. PMID: 19258013

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.