Recombinant Mouse Histone H3-Like Centromeric Protein A (CENPA) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10726P
Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse Histone H3-Like Centromeric Protein A (CENPA) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10726P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mouse Histone H3-Like Centromeric Protein A (CENPA) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | O35216 |
| Target Symbol | CENPA |
| Synonyms | CenpaHistone H3-like centromeric protein A; Centromere protein A; CENP-A |
| Species | Mus musculus (Mouse) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | MGPRRKPQTPRRRPSSPAPGPSRQSSSVGSQTLRRRQKFMWLKEIKTLQKSTDLLFRKKPFSMVVREICEKFSRGVDFWWQAQALLALQEAAEAFLIHLFEDAYLLSLHAGRVTLFPKDIQLTRRIRGFEGGLP |
| Expression Range | 1-134aa |
| Protein Length | Full Length |
| Mol. Weight | 17.5kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Histone H3-like nucleosomal protein that is specifically found in centromeric nucleosomes. Replaces conventional H3 in the nucleosome core of centromeric chromatin at the inner plate of the kinetochore. The presence of CENPA subtly modifies the nucleosome structure and the way DNA is wrapped around the nucleosome and gives rise to protruding DNA ends that are less well-ordered and rigid compared to nucleosomes containing histone H3. May serve as an epigenetic mark that propagates centromere identity through replication and cell division. Required for recruitment and assembly of kinetochore proteins, and as a consequence required for progress through mitosis, chromosome segregation and cytokinesis. |
| Subcellular Location | Nucleus. Chromosome, centromere, kinetochore. Chromosome, centromere. |
| Protein Families | Histone H3 family |
| Database References | KEGG: mmu:12615 STRING: 10090.ENSMUSP00000122831 UniGene: PMID: 28756949 |
