Recombinant Mouse Heme Oxygenase 1 (HMOX1) Protein (His-B2M)

Beta LifeScience SKU/CAT #: BLC-08632P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Mouse Heme Oxygenase 1 (HMOX1) Protein (His-B2M)

Beta LifeScience SKU/CAT #: BLC-08632P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Mouse Heme Oxygenase 1 (HMOX1) Protein (His-B2M) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb P14901
Target Symbol HMOX1
Synonyms Hmox1; Heme oxygenase 1; HO-1; EC 1.14.14.18; P32 protein
Species Mus musculus (Mouse)
Expression System E.coli
Tag N-6His-B2M
Target Protein Sequence MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQTPLLQWVLTLSFLLATVAVGIYAM
Expression Range 1-289aa
Protein Length Full Length
Mol. Weight 46.9 kDa
Research Area Cell Biology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. Exhibits cytoprotective effects since excess of free heme sensitizes cells to undergo apoptosis.
Subcellular Location Microsome. Endoplasmic reticulum membrane; Peripheral membrane protein; Cytoplasmic side.
Protein Families Heme oxygenase family
Database References

KEGG: mmu:15368

STRING: 10090.ENSMUSP00000005548

UniGene: PMID: 30327713

  • Ori might exhibit a protective role against H2O2-stimulated oxidative damage by the induction of HO-1 expression through the activation of the JNK- and PI3K/AKT-Nrf2 signaling pathways. PMID: 29959995
  • This is the first study to demonstrate the regulatory role of HO-1 in silicosis. PMID: 30068325
  • The HO-1-mediated pathway is involved in the suppressive effects of FNDC4 on inflammation and insulin resistance. PMID: 29787756
  • HO-1 enhanced STAT3 phosphorylation, which enriched to Il12b and Il23a loci and negatively regulated their transcription. These findings demonstrate the underlying mechanism through which a nutritional can interfere with the immune response. CUR silences IL-23/Th17-mediated pathology by enhancing HO-1/STAT3 interaction in dendritic cells. PMID: 28290522
  • HO-1 reduces HFD-induced AKT2 phosphorylation via ROS thresholding in mitochondria to reduce visceral adipose precursor proliferation. HO-1 influences adipogenesis in a cell-autonomous way by regulating events early in adipogenesis, during the process of mitotic clonal expansion, upstream of Cebpalpha and PPARgamma. PMID: 28102348
  • Involved in the Nrf2/HO-1 pathway. PMID: 29730008
  • Studied effect of Sargassum horneri (Turner) C. Agardh ethanol extract (SHE) on inflammation induced by fine dust in RAW 264.7 cells. Results suggest SHE protects the cells from oxidative stress in part by activating the nuclear factor erythroid derived 2 like 2 /heme oxygenase 1 (Nrf2/HO-1) signal pathway. PMID: 30200963
  • Our results reveal a previously unrecognized function of HO-1 in regulating SMC gene expressions during ESC-EB development. PMID: 29216542
  • HO-1 protects bone marrow mesenchymal stem cells from reactive oxygen species by secreting IL-10 upon iron overload. PMID: 29111167
  • Results show that renal myeloid cells upregulate HO-1 upon renal ischemia-reperfusion injury (IRI). Also, myeloid HO-1 mitigates both innate immune responses and oxidative stress upon renal IRI. PMID: 28298633
  • Findings demonstrate that myeloid HO-1 plays an anti-inflammatory role in the acute response to zymosan in vivo. PMID: 29599896
  • Genetic Hmox1 partial deficiency is sufficient to sensitize mice to the development of diabetic glomerular microvascular lesions. HO-1 exerts antioxidant effects in the kidney during diabetes mellitus. These have protective effects on the development of glomerular endothelial injury. PMID: 29359167
  • Inhibition of miR-92a attenuates oxidative stress and improves endothelial function through enhancing HO-1 expression and activity in db/db mouse aortas PMID: 28683566
  • n-propargyl caffeamide (PACA) attenuated LPS-induced NF-kB activation while activated Nrf2/HO-1 pathway. HO-1 inhibitor SnPP attenuated the effects of PACA on iNOS expression in LPS-challenged macrophages, possibly by regulating the cross-talk between HO-1 and NF-kB pathways. PMID: 29996121
  • Ablation of adipose tissue-HO-1 abridged PGC1 expression promoted mitochondrial dysfunction and contributed to an increase of pro-inflammatory visceral fat and abrogated beige-cell like phenotype. PMID: 28763300
  • These results suggested that schisandrin A has a protective effect against LPS-induced inflammatory and oxidative responses in RAW 264.7 cells by inhibiting the NF-kappaB, MAPK and PI3K/Akt pathways; these effects are mediated, at least in part, by the activation of the Nrf2/HO-1 pathway PMID: 29115385
  • Newborns appear to be protected from the pro-oxidative effects of free heme (FH), which may be mediated by heme binding and a higher absolute HO activity at baseline and after FH-mediated induction. PMID: 28926834
  • Rosiglitazone Regulates TLR4 and Rescues HO-1 and NRF2 Expression in Myometrial and Decidual Macrophages in Inflammation-Induced Preterm Birth. PMID: 28322133
  • this study shows that induction of heme oxygenas-1 attenuates NLRP3 inflammasome activation in lipopolysaccharide-induced mastitis in mice PMID: 28938188
  • DADLE was able to significantly improve hepatic I/R injury in mice, and the specific mechanism may be associated with the Nrf2/HO1 signaling pathway. PMID: 28901476
  • HO-1 role in the feedback response to blood carbon monoxide depletion PMID: 27057920
  • Pretreatment with Zinc L-carnosine was able to activate Nrf2/HO-1 signaling pathway, thus suppressing the expression of inflammatory mediators, such as NO and iNOS in LPS-induced RAW 264.7 cells. PMID: 28697633
  • Study demonstrated that a higher level of HO-1 associated with higher levels of injury severity, histological lesions and behavioral deficits in males than in females was induced by striatal ferrous citrate-infusion, which simulates iron overload in the striatum after intracerebral hemorrhage. PMID: 27198537
  • these results indicate that MaR 1 protects against lung I/R injury through suppressing oxidative stress. The mechanism is partially explained by activation of the Nrf-2-mediated HO-1 signaling pathway. PMID: 28751936
  • Splenic Ly6C(hi) monocytes contribute to adverse late post-ischemic left ventricular remodeling in heme oxygenase-1 deficient mice. PMID: 28534119
  • findings suggest that HO-1 protects against I/R-induced hepatic injury via regulation of mitochondrial QC by PGAM5 signaling. PMID: 29524517
  • this study shows that heme oxygenase 1 affects granulopoiesis in mice through control of myelocyte proliferation PMID: 28576353
  • HO-1(pos) /CD169(neg) macrophages in jejunal serosa and at Auerbach's plexus up-regulated by lipopolysaccharide PMID: 27860408
  • The results demonstrated that restoration of Brg1 during reperfusion could enhance Nrf2-mediated inducible expression of HO-1 during hepatic ischemia-reperfusion injury to effectively increase antioxidant ability to combat against hepatocytes damage. PMID: 28569786
  • report that TLR signaling involving MyoD88 has a negative role in egress of HSPCs from BM into PB as TLR signaling enhances expression of HO-1 in hematopoietic cells PMID: 27560112
  • Taken together, these findings suggest that 2,3,5,4'-Tetrahydroxystilbene-2-O-beta-D-glucoside (TSG) enhances mitochondrial biogenesis and function mainly via activation the HO-1. TSG can be developed as a potential drug for treatment of inflammatory diseases. PMID: 28473878
  • The in vitro study illustrated that the anti-inflammatory effects of RA-XII were partially reversed following Nrf2 and HO-1 inhibition. Together, these findings strongly suggested that RA-XII is a potential agent against acute kidney injury. PMID: 29277609
  • mRNA and protein levels of heme oxygenase-1 (HO-1)aresignificantly increased by Melaleuca alternifolia oil via p38 and JNK MAPK activation. PMID: 29121804
  • Together with results showing involvement of TTF-1 in the TNF-alpha-induced increase in interleukin 1 beta and monocyte chemotactic protein 1 production, this study suggests that TTF-1 plays an important role in the mouse hypothalamus TNF-alpha-induced inflammatory response for regulating HO-1 gene expression. PMID: 29305861
  • Curtailment of glial HO-1 transduction at strategic points of the life course may confer neuroprotection in human degenerative and developmental central nervous system disorders. PMID: 28746897
  • Results indicate the essential roles of heme oxygenase-1 (HO-1) in suppressing the pathogenesis of abdominal aortic aneurysm (AAA), suggesting targeting HO-1 might be a promising therapeutic strategy for AAA. PMID: 27626316
  • inadequate HO-1 in striatal astrocytes might contribute to the limited antioxidant defense and dopaminergic neuron degeneration in PD, and preferential HO-1 activation in striatal astrocytes might be neuroprotective. PMID: 26385576
  • results indicate that high expression of HO-1 may reduce the severity of acute graft-versus-host disease by regulation of the TH17/Treg balance PMID: 27168057
  • YZH-106 induced p38 MAPK and ERK1/2 phosphorylation, which led to the activation of erythroid 2-related factor 2 (Nrf2) that up-regulated heme oxygenase-1 (HO-1) expression in addition to other genes. PMID: 27107768
  • our data indicate that luteolin diminishes the proinflammatory mediators NO, inflammatory cytokines and the expression of their regulatory genes, iNOS and COX-2, in PRV-infected RAW264.7 cells by inhibiting STAT1/3 dependent NF-kappaB activation and inducing Nrf2mediated HO-1 expression. PMID: 27016074
  • we demonstrate that RG induces HO-1 expression by promoting phosphorylation of Nrf2 at Ser40 through activation of the ERK1/2 and JNK cascade in macrophages. PMID: 28257879
  • We conclude that 1) CIH induces expression of HO-1 in the C1 and pre-BotC regions within 1 day and 2) HO-1 is necessary for hypoxia respiratory response and contributes to the maintenance of the hypoxic sigh responses and baseline sympathetic activity during CIH. PMID: 27609199
  • this study demonstrates that ammonia stimulates the expression of HO-1 in endothelial cells via the ROS-Nrf2 pathway, and that the induction of HO-1 contributes to the cytoprotective action of ammonia by generating carbon monoxide. Moreover, it identifies ammonia as a potentially important signaling gas in the vasculature that promotes endothelial cell survival. PMID: 27867098
  • HO-1 influences granulopoiesis through regulation of myelocyte proliferation. It is accompanied by changes in expression of transcriptionally active C/EBPbeta protein. PMID: 27817989
  • EET-mediated increase in HO-1 levels require PGC-1alpha expression PMID: 27418542
  • Downregulation of inducible NO synthetase (iNOS) resulted in downregulation of heme oxygenase 1 (HO-1), and, conversely, upregulation of iNOS enhanced HO-1 activity. PMID: 27752990
  • Data suggest the a decrease in migration of hematopoietic stem progenitor cells (HSPCs) can be explained by impaired calcium release in phospholipase C-beta2 (PLC-beta2) knockout (KO) mice and a high baseline level of heme oxygenase 1 (HO-1), an enzyme that negatively regulates cell migration. PMID: 27704316
  • HO-1 expression is upregulated by hydrogen-rich water in a mouse model of in fl ammatory bowel disease, which also inhibits inflammatory factors, and oxidative stress and ER stress PMID: 28293084
  • study demonstrates that human respiratory syncytial virus (hRSV) infection can be modulated by the expression of HO-1 both in vitro and in vivo; thus, HO-1 activity may play a critical role during hRSV infection PMID: 28566367
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed