Recombinant Mouse H-2 Class I Histocompatibility Antigen, K-B Alpha Chain (H2-K1) Protein (His)

Name: Recombinant Mouse H-2 Class I Histocompatibility Antigen, K-B Alpha Chain (H2-K1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-07223P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Mouse H-2 Class I Histocompatibility Antigen, K-B Alpha Chain (H2-K1) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P01901
Target Symbol	H2-K1
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPPSTVSNM
Expression Range	22-305aa
Protein Length	Partial
Mol. Weight	38.6 kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Involved in the presentation of foreign antigens to the immune system.
Subcellular Location	Membrane; Single-pass type I membrane protein.
Protein Families	MHC class I family
Database References	KEGG: mmu:14972 STRING: 10090.ENSMUSP00000025181 UniGene: Mm.422886

Gene Functions References

Major histocompatibility class I molecules H2-Kb and H2-Db proteins regulate sculpting of local cortical circuits and in their absence, the excess connectivity can function as a substrate for cortical plasticity throughout life. PMID: 25316337
H-2Kb in an unfolded form to a post-endoplasmic reticulum compartment from where they can cycle back to the endoplasmic reticulum. PMID: 26714929
tissue-specific h-2K(d) transgenic mice may be valuable tools for determining the mode of induction of CD8(+) T-cell responses. PMID: 23142461
Analysis of CD8-positive T lymphocytes responsive to an H-2Kb-restricted immunodominant peptide displays T cell-homing patterns that support surveillance of both upper- and lower respiratory tract tissues by clonally related cells. PMID: 21690324
Adult mice exposed to a noninherited maternal antigen accepts permanently H2-Kb-positive heart allografts despite the presence of normal levels of anti-K(b) T cell receptor transgenic T cells. PMID: 21178009
Major histocompatibility class Ib-restricted CD8-positive T cells, in addition to H2-M3-restricted T cells, contribute to antilisterial immunity and may contribute to immune responses against other intracellular bacteria. PMID: 21098224
The interaction of SHIP, 2B4 activating receptor, and the major histocompatibility complex influence the regulation of the natural killer (NK) cell receptor repertoire, cytolytic function, and interferon-gamma production. PMID: 20363967
Data imply that a cognate linkage between TLR3 and MHC class I is required for efficient CTL priming to HSV-1. PMID: 20124105
Endoplasmic reticulum aminopeptidase (ERAAP)-deficiency changes the antigen processing mechanism and causes a marked increase in the length of peptides normally presented by the histocompatibility class I-peptide binding groove. PMID: 20173027
Data provide biological confirmation that the chromosome 6 QTL provided MCMV control independent of H-2(k) via NK cells. PMID: 19820922
showed that a large disulfide-bonded complex was present in the mouse cells that included ERp57, tapasin, and K(d). PMID: 19687800
Analysis of structure and function relationships of an autoantigenic peptide of insulin bound to H-2K(d) that stimulates CD8 T cells in insulin-dependent diabetes mellitus. PMID: 11943852
intramembrane mechanism by which unassembled H2Kb molecules are retained in the endoplasmic reticulum of fibroblasts PMID: 12006653
The H2-K(b) gene belongs to target genes of the NF-IL6 (C/EBPbeta) in the course of the cellular response to TNF-alpha. Some consequences of this are discussed in a general framework of inducible expression of the H2-K(b) gene. PMID: 12184911
linked mhc polymorphism-driven diversification of the cytotoxic T lymphocyte repertoire to the generation of high-avidity, protective antiviral T cells and to superior antiviral defense PMID: 12459592
crystal structure complexed with an HBV-core nonapeptide PMID: 15272181
signaling through the mouse NK inhibitory receptor Ly49C requires the presence of H-2Kb and this signaling is prevented when H-2Kb is ablated by pulsing with a peptide that can bind to it with high affinity PMID: 16148097
two H-2K(k)-peptide complexes provide insights into the mechanisms through which MHC polymorphism outside primary peptide pockets influences the conformation of the bound peptides and have implications for TCR recognition PMID: 16148128
Linkage analysis performed in F(2) backcross ([BALB/c x C3H/HeN] x BALB/c) mice carrying the H2(k) region confirmed the presence of a susceptibility locus within the H2 region on proximal chromosome 17. PMID: 16148132
analysis of K(d)-restricted antigen presentation and recognition events PMID: 16473882
These results demonstrate that Ly49Q efficiently binds H-2K(b) ligand. PMID: 17240452
Study presents the 2.35 A structure of the 2C TCR complexed with its foreign ligand H-2L(d)-QL9; surprisingly, TCR utilizes a different strategy to engage the foreign pMHC in comparison to the manner in which it recognizes a self ligand H-2K(b)-dEV8. PMID: 17418792
Naive polyclonal class Ib-restricted CD8-positive T cells have the ability to homeostatically expand in the periphery in a largely class Ib-dependent manner. PMID: 18292501
the mHpa398 and mHpa519 peptides are novel H-2K(b)-restricted CTL epitopes capable of inducing heparanase-specific CTLs in vitro and in vivo PMID: 18316618
an unsuspected role for the MHC-I-Ly49 interaction in the development and function of the brain. PMID: 18453559
data suggest that APLP2 modulates the stability and endocytosis of K(d) molecules PMID: 18641335
Ethanol-elicited reduction in proteasome activity contributes to the suppression of SIINFEKL-H2Kb presentation on the surface of liver cells. PMID: 19195028
These physiological and behavioral phenotypes in K(b)D(b-/-) mice reveal a surprising role for classical MHCI molecules in synaptic plasticity and motor learning. PMID: 19346486
the MHC class I D locus prompts expansion and activation of Ly49G2(+) NK cells that are needed in H-2(k) MCMV resistance. PMID: 19454713
comparison of the consequences of MHC overexpression in muscle at different ages;a markedly more severe disease phenotype in young mice, with rapid onset of muscle weakness and pathology PMID: 19700752
H2-Kb and H2-Db ligands, signaling via neuronal class I histocompatibility antigen receptors, may enable activity-dependent remodeling of brain circuits during developmental critical periods. PMID: 19945389

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.