Recombinant Mouse Glycoprotein Hormone Beta-5 (GPHB5) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-01442P

Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse Glycoprotein Hormone Beta-5 (GPHB5) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-01442P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Glycoprotein Hormone Beta-5 (GPHB5) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q812B2 |
Target Symbol | GPHB5 |
Synonyms | Thyrostimulin subunit beta |
Species | Mus musculus (Mouse) |
Expression System | Yeast |
Tag | C-6His |
Target Protein Sequence | SSSGNLHTFVGCAVREFTFMAKKPGCRGLRITTDACWGRCETWEKPILEPPYIEAYHRVCTYNETRQVTVKLPNCAPGVDPFYTYPMAVRCDCGACSTATTECETI |
Expression Range | 25-130aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 13.3 kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Functions as a heterodimeric glycoprotein hormone with GPHA2 able to bind and activate the thyroid-stimulating hormone receptor (TSHR), leading to increased cAMP production. Plays a central role in controlling thyroid cell metabolism. |
Subcellular Location | Secreted. |
Protein Families | Glycoprotein hormones subunit beta family |
Database References | KEGG: mmu:217674 STRING: 10090.ENSMUSP00000061488 UniGene: PMID: 25117405 |