Recombinant Mouse Glutaminyl-Peptide Cyclotransferase (QPCT) Protein (His-Myc)
Beta LifeScience
SKU/CAT #: BLC-02564P
Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse Glutaminyl-Peptide Cyclotransferase (QPCT) Protein (His-Myc)
Beta LifeScience
SKU/CAT #: BLC-02564P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mouse Glutaminyl-Peptide Cyclotransferase (QPCT) Protein (His-Myc) is produced by our Mammalian cell expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q9CYK2 |
| Target Symbol | QPCT |
| Synonyms | Qpct; Glutaminyl-peptide cyclotransferase; EC 2.3.2.5; Glutaminyl cyclase; QC; Glutaminyl-tRNA cyclotransferase |
| Species | Mus musculus (Mouse) |
| Expression System | Mammalian cell |
| Tag | N-6His-Myc |
| Target Protein Sequence | AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYLHL |
| Expression Range | 36-362aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 41.6kDa |
| Research Area | Neuroscience |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. |
| Subcellular Location | Secreted. |
| Protein Families | Glutaminyl-peptide cyclotransferase family |
| Database References | KEGG: mmu:70536 STRING: 10090.ENSMUSP00000038732 UniGene: PMID: 26447138 |
