Recombinant Mouse Glucagon-Like Peptide 1 Receptor (GLP1R) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-02294P
Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse Glucagon-Like Peptide 1 Receptor (GLP1R) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-02294P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mouse Glucagon-Like Peptide 1 Receptor (GLP1R) Protein (His-SUMO) is produced by our E.coli expression system. This is a extracellular protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | O35659 |
| Target Symbol | GLP1R |
| Synonyms | Glp1rGlucagon-like peptide 1 receptor; GLP-1 receptor; GLP-1-R; GLP-1R |
| Species | Mus musculus (Mouse) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY |
| Expression Range | 22-145aa |
| Protein Length | Extracellular Domain |
| Mol. Weight | 30.4kDa |
| Research Area | Neuroscience |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellular cAMP levels. Plays a role in regulating insulin secretion in response to GLP-1. |
| Subcellular Location | Cell membrane; Multi-pass membrane protein. |
| Protein Families | G-protein coupled receptor 2 family |
| Database References | KEGG: mmu:14652 STRING: 10090.ENSMUSP00000110221 UniGene: PMID: 28572610 |
