Recombinant Mouse Glucagon-Like Peptide 1 Receptor (GLP1R) Protein (His-SUMO)

Name: Recombinant Mouse Glucagon-Like Peptide 1 Receptor (GLP1R) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-02294P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Glucagon-Like Peptide 1 Receptor (GLP1R) Protein (His-SUMO) is produced by our E.coli expression system. This is a extracellular protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	O35659
Target Symbol	GLP1R
Synonyms	Glp1rGlucagon-like peptide 1 receptor; GLP-1 receptor; GLP-1-R; GLP-1R
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY
Expression Range	22-145aa
Protein Length	Extracellular Domain
Mol. Weight	30.4kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellular cAMP levels. Plays a role in regulating insulin secretion in response to GLP-1.
Subcellular Location	Cell membrane; Multi-pass membrane protein.
Protein Families	G-protein coupled receptor 2 family
Database References	KEGG: mmu:14652 STRING: 10090.ENSMUSP00000110221 UniGene: PMID: 28572610 chronotherapeutic modulation of vagal afferent GLP-1R signaling may aid in treating metabolic disorders. PMID: 29317623 Presynaptic GLP-1 receptors enhance the depolarization-evoked release of glutamate and GABA in the mouse cortex and hippocampus. PMID: 29265673 This study presents an unexpected proinflammatory switch from Galphas to GalphaI glp1r signaling in burn monocytes which promotes ERK1/2 and NF-kappaB activation PMID: 29022064 GLP-1R signaling in paraventricular thalamic nucleus plays a role in food intake control. PMID: 28811669 GLP-1 receptor agonists suppress the progression of atherosclerosis by inhibiting vascular smooth muscle cell proliferation and enhancing AMP-activated protein kinase and cell cycle regulation in ApoE deficient mice. PMID: 28445811 IL-33, GLP-1R, and CCL20 are deregulated in human inflammatory bowel disease. GLP-1 receptor agonists upregulate IL-33, mucin 5b, and CCL20 in murine Brunner's glands. GLP-1 receptor agonists affect gut homeostasis in both proximal and distal parts of the gut. PMID: 27542128 findings identify a group of proteins that interact with GLP-1R and show that one specific interacting protein, SERP1, has an important role in facilitating the glycosylation of GLP-1R and rescuing its activities after ER stress induced by tunicamycin. PMID: 28597972 Suggest transcription factor 7-like 2 is a possible regulator of glucagon-like peptide 1 receptor expression in endothelial/smooth muscle cells in diabetic mice. PMID: 28830217 ventromedial hypothalamus GLP-1R regulates food intake by engaging key nutrient sensors but is dispensable for the effects of GLP-1RA on nutrient homeostasis PMID: 28811293 GLP-1R is highly expressed within the lateral septum. PMID: 27187231 Study showe that GLP-producing fibers interact with hypothalamic arcuate nucleus (ARC) Kiss1 cells that express GLP-1R, and GLP-1R signaling directly activates ARC Kiss1 function in an estradiol-independent manner. Pharmacological activation of GLP-1R signaling during fasting or pharmacological inhibition of CNS GLP-1R signaling during normal feeding does not alter circulating luteinizing hormone levels. PMID: 28144621 The increased calcium response mediated by secretin in the absence of GLP-1R was paralleled by an increased glucose-dependent insulin response, indicating that the heterodimeric receptor complexes modulate secretin responses. PMID: 28368447 Menin and PRMT5 suppress GLP1R transcript levels and PKA-mediated phosphorylation of FOXO1 and CREB. PMID: 28270438 Glp1r knockdown reduced anxiety-like behavior, implicating paraventricular nucleus GLP-1 signaling in behavioral stress reactivity PMID: 28053040 Enhanced beta-cell GLP-1R signaling contributes to improved glucose regulation after vertical sleeve gastrectomy by promoting increased glucose-stimulated insulin secretion. PMID: 27501183 Results suggest a detectable but only modest role for GLP-1R signaling in mediating the effects of Roux-en-Y gastric bypass and that this role is limited to its well-described action on glucose regulation. PMID: 27026085 Hypothalamic Glp1r is sufficient but not necessary for regulation of energy balance and glucose homeostasis. PMID: 27908915 Genetic deletion of both GLP-1 and GIP receptors reveals that they are required to maintain an adequate islet number in adulthood and to maintain normal beta cell responses to glucose. PMID: 27020250 present study provides critical insights regarding the nature by which GLP-1 signaling controls reinforced behaviors and underscores the importance of both peripheral and central GLP-1R signaling for the regulation of addictive disorders. PMID: 27072507 These differential effects of exogenous Glp1r in nondiabetic and diabetic mice suggest that downregulation of Glp1r might be required to slow the progression of beta-cell failure under diabetic conditions. PMID: 26854076 although endogenous GLP-1R signalling contributes to increased brown adipose tissue thermogenesis, this mechanism does not play a significant role in the food intake-independent body weight lowering effect of the GLP-1 mimetic liraglutide in obese mice PMID: 26049402 GLP-1R is present in pancreatic acinar cells and that GLP-1 can regulate secretion through its receptor and cAMP signaling pathway. PMID: 26542397 GLP1R is expressed in mouse retina. GLP-1R protein abundance was independent of the presence of diabetes. PMID: 26384381 The data of this study reveal a novel role of GLP-1R in dorsal lateral septum function driving behavioral responses to cocaine. PMID: 25669605 GLP-1R agonism significantly reduced alcohol consumption in a mouse model of alcohol dependence. PMID: 26080318 these data provide novel evidence that lipotoxicity decreases the mesangial GLP-1R expression in intact cells and in vivo. PMID: 26302449 These results support a role for extra islet GLP1R in oral glucose tolerance and paracrine regulation of beta cells by islet GLP-1. PMID: 24836562 For the binding between 125I-liraglutide and the GLP-1 receptor on the surface of INS-1 cells, the equilibrium dissociation constant (Kd) was 128.8 +/- 30.4 nmol/L(N = 3), and the half-inhibition concentration (IC50) was 542.4 +/- 187.5 nmol/L(N = 3). PMID: 24805918 GLP-1 receptors are located in the renal vasculature, including afferent arterioles. Activation of these receptors reduces the autoregulatory response of afferent arterioles to acute pressure increases and increases RBF in normotensive rats. PMID: 25656368 our data demonstrate that the expression of GLP-1R and GIPR is regulated by glucose concentrations in MC3T3-E1 cells undergoing differentiation induced by BMP-2. PMID: 24866833 GLP-1R on POMC/CART-expressing ARC neurons likely mediates liraglutide-induced weight loss PMID: 25202980 GLP-1R signaling upregulates renal NAD(P)H oxidase and increases renal oxidative stress, with reduced levels of renal cAMP-PKA activity in the setting of chronic hyperglycemia accentuating the progression of diabetic nephropathy. PMID: 24152968 Activation of GLP-1R in spinal cord leads to antinociception in pain hypersensitivity. PMID: 25247855 GLP-1R is shown to be a recycling receptor. PMID: 24275181 Binding of the novel ligand [125I]GLP-1(9-36) is studied in mouse tissues as well as the parameters of equilibrium dissociation constant, functional activity, and GLP-1 receptor density, compared with GLP-1(7-36). PMID: 24641952 Exenatide requires a functional GLP-1R to exert chronic metabolic effects in mice. PMID: 24477544 Our findings indicate that the GLP-1r is involved in ileal enterocyte and Paneth cell function PMID: 23927844 The results provide no support for important individual roles of either gut hormone in the specific mechanisms by which RYGB rats settle at a lower body weight. PMID: 24430883 A novel GLP-1R-protein interactome was generated, identifying several interactors that suppress GLP-1R signaling. PMID: 23864651 mice lacking GLP1R appear to have decreased bone strength observed at anatomical level with decrease in 3-point bending resistance and decreased Ct.Th. Bone strength was reduced at tissue level and was associated with reductions of collagen cross-linking PMID: 23911987 GLP-1R agonism reverses cardiac remodeling and dysfunction observed in T2DM via normalizing imbalance of lipid metabolism and related inflammation/oxidative stress. PMID: 23709595 there is a gut-heart GLP-1R-dependent and ANP-dependent axis that regulates blood pressure and involves Epac2 PMID: 23542788 Functional disruption of the Glp1r results in exercise-induced hyperglycaemia associated with an excessive increase in glucagon secretion and hepatic glucose production PMID: 22890715 Activation of the central GLP-1R reduces food intake via glucose metabolism-dependent inhibition of central AMPK. Fructose stimulates food intake by impairing central GLP-1R action. PMID: 23341495 GLP-1 receptor activation inhibits VLDL production and reverses hepatic steatosis by decreasing hepatic lipogenesis in high-fat-fed APOE*3-Leiden mice PMID: 23133675 Data suggest that both glucagon-like peptide 1/Glp1r signal transduction and glucagon receptor activity in central nervous system are involved in control of interscapular brown adipose tissue thermogenesis. PMID: 22933116 GLP-1 and liraglutide activate the GLP-1R, thereby promoting pre-adipocyte proliferation and inhibition of apoptosis. PMID: 22207759 C-cell effects in mice are mediated via the GLP-1 receptor and not associated with RET activation PMID: 22234463 low levels of endogenous GLP-1 secreted from gut endocrine cells are capable of augmenting glucoregulatory activity via pancreatic GLP-1Rs independent of communication with neural pathways PMID: 22182839

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Mouse Glucagon-Like Peptide 1 Receptor (GLP1R) Protein (His-SUMO)

Recombinant Mouse Glucagon-Like Peptide 1 Receptor (GLP1R) Protein (His-SUMO)

Product Overview

Target Details

FAQs