Recombinant Mouse Gdnf Family Receptor Alpha-Like (GFRAL) Protein (His&Myc), Active
Beta LifeScience
SKU/CAT #: BLC-05814P
Recombinant Mouse Gdnf Family Receptor Alpha-Like (GFRAL) Protein (His&Myc), Active
Beta LifeScience
SKU/CAT #: BLC-05814P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mouse Gdnf Family Receptor Alpha-Like (GFRAL) Protein (His&Myc), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | Measured by its binding ability in a functional ELISA. Immobilized Mouse Gfral at 5 μg/mL can bind Mouse Gdf15 , the EC 50 is 7.926-10.52 ng/mL. |
| Uniprotkb | Q6SJE0 |
| Target Symbol | GFRAL |
| Species | Mus musculus (Mouse) |
| Expression System | Mammalian cell |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | QTNDCAHLIQKCLIDANGCEQSWRSMEDTCLTPGDSCKINNSLHCNLSIQALVEKNFQFKECLCMDDLHCTVNKLFGKKCTNKTDNMEKDNKDKWNLTTTPFYHGFKQMQSCLEVTEACVGDVVCNAQLALYLKACSANGNLCDVKHCQAAIRFFYQNMPFNTAQMLAFCDCAQSDIPCQQSKETLHSKPCALNIVPPPTCLSVIHTCRNDELCRTHYRTFQTECWPHITGKCHEDETCISMLGKQDLTCSGSESCRAAFLGTFGTVLQVPCACRGVTQAEEHVCMIFQHMLHSKSCFNYPTPNVKDISSYEKKNSKEITLTGFNSFFNG |
| Expression Range | 20-349aa |
| Protein Length | Partial |
| Mol. Weight | 42.1 kDa |
| Research Area | Cell Biology |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Brainstem-restricted receptor for GDF15 which regulates food intake, energy expenditure and body weight in response to metabolic and toxin-induced stresses. Upon interaction with its ligand, GDF15, interacts with RET and induces cellular signaling through activation of MAPK- and AKT- signaling pathways. |
| Subcellular Location | Cell membrane; Single-pass membrane protein; Extracellular side. |
| Protein Families | GDNFR family |
| Database References | KEGG: mmu:404194 UniGene: PMID: 28953886 |
