Recombinant Mouse Gastric Inhibitory Polypeptide Receptor (GIPR) Protein (His), Active

Name: Recombinant Mouse Gastric Inhibitory Polypeptide Receptor (GIPR) Protein (His), Active
Brand: Beta LifeScience
SKU: BLC-05709P
Price: 693.6 USD
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Activity Measured by its binding ability in a functional ELISA. Immobilized Mouse Gipr at 2μg/mL can bind Anti-Mouse Gipr recombinant antibody ， the EC 50 is 8.622-11.36 ng/mL. Biological Activity Assay

Collections: Featured immune checkpoint protein molecules, Immune checkpoint proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Gastric Inhibitory Polypeptide Receptor (GIPR) Protein (His), Active is produced by our Mammalian cell expression system. This is a protein fragment.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Activity	Measured by its binding ability in a functional ELISA. Immobilized Mouse Gipr at 2 μg/mL can bind Anti-Mouse Gipr Recombinant Antibody , the EC50 is 8.622-11.36 ng/ml.
Uniprotkb	Q0P543
Target Symbol	GIPR
Synonyms	Gastric inhibitory polypeptide receptor;GIP-R;Glucose-dependent insulinotropic polypeptide receptor;Gipr
Species	Mus musculus (Mouse)
Expression System	Mammalian cell
Tag	C-10His
Target Protein Sequence	ETDSEGQTTTGELYQRWEHYGQECQKMLETTEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWFRQVSAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQTLILERLQ
Expression Range	19-134aa
Protein Length	Partial
Mol. Weight	14.7 kDa
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	This is a receptor for GIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Subcellular Location	Cell membrane; Multi-pass membrane protein.
Protein Families	G-protein coupled receptor 2 family
Database References	KEGG: mmu:381853 STRING: 10090.ENSMUSP00000092384 UniGene: Mm.333633

Gene Functions References

The study provides evidence that the insulinotropic action of zfGIP in mammalian systems involves activation of both the GLP-1 and the GIP receptors but not the glucagon receptor PMID: 29157578
Microarray analysis revealed that pregnancy-specific glycoprotein 17 (Psg17), a potential CD9-binding partner, was significantly decreased in GIP receptor-knockout (Gipr-/-) testes. PMID: 28430907
GIPR signaling in adipose tissue plays a critical role in high fat diet-induced insulin resistance and hepatic steatosis in vivo, which may involve IL-6 signaling. PMID: 28096257
Genetic deletion of both GLP-1 and GIP receptors reveals that they are required to maintain an adequate islet number in adulthood and to maintain normal beta cell responses to glucose. PMID: 27020250
Results suggest the beneficial effects of glucose-dependent insulinotropic polypeptide on periodontal disease. PMID: 27181102
Gipr(-/-) offspring of mice exposed to high fat diet(HFD) during pregnancy/lactation became insulin resistant and obese and exhibited increased adipose tissue inflammation and decreased peripheral tissue substrate utilization after reintroduction of HFD. PMID: 26631738
Beta-cell Gipr KO mice exhibit lower levels of meal-stimulated insulin secretion, decreased expansion of adipose tissue mass and preservation of insulin sensitivity and decreased TCF1 expression. PMID: 26642437
Gipr is expressed in healthy arteries, predominantly in endothelial cells. PMID: 26395740
These data highlighted the importance of intact GIPR signalling and dietary composition in modulating memory and learning, and hippocampal pathways involved in the maintenance of synaptic plasticity PMID: 25760229
Functional GIP receptors play a major role in islet compensatory response to high fat feeding in mice. PMID: 25688757
our data demonstrate that the expression of GLP-1R and GIPR is regulated by glucose concentrations in MC3T3-E1 cells undergoing differentiation induced by BMP-2. PMID: 24866833
Results show that GIPR undergoes trafficking between the plasma membrane and intracellular compartments of both GIP-stimulated and unstimulated adipocytes. PMID: 25047836
Structural and pharmacological characterization of novel potent and selective monoclonal antibody antagonists of glucose-dependent insulinotropic polypeptide receptor. PMID: 23689510
a role of the adipocyte GIPr in nutrient-dependent regulation of body weight and lean mass, but it does not support a direct and independent role for the adipocyte or beta-cell GIPr in promoting adipogenesis. PMID: 22027838
Gipr is essential for adrenal steroidogenesis and links high fat (HF) feeding to increased levels of corticosterone, reduced glucocorticoid levels do not significantly contribute to the enhanced metabolic phenotypes in HF-fed Gipr(-/-) mice. PMID: 22043004
GIPR(dn) transgenic mice show a disturbed expansion of the endocrine pancreas, due to perturbed islet neogenesis. PMID: 21818396
GIP receptors play an important role in cognition, neurotransmission, and cell proliferation. PMID: 21273318
Both GIPR protein and mRNA expression increased during cell differentiation, and this increase was associated with upregulation of nuclear levels of SREBP-1c and PPARgamma, as well as acetylation of histones H3/H4. PMID: 21245029
GIPR(-/-) mice exhibit altered islet structure and topography and increased islet sensitivity to glucagon-like peptide-1 despite a decrease in pancreatic insulin content and gene expression PMID: 12540373
Results demonstrate that glucose intolerance was additively increased during oral glucose absorption when both gastric inhibitory polypeptide receptors and glucagon-like peptide 1 receptors were inactivated. PMID: 14966573
intact signaling of G-protein coupled receptors is involved in postnatal islet and beta-cell development and neogenesis of the pancreatic islets PMID: 15582721
Adult GIP receptor knock-out mice exhibit a significantly lower number of newborn cells in the hippocampal dentate gyrus compared with wild-type mice. PMID: 15716418
long term activation of the GIP receptor by daily treatment with N-AcGIP(LysPAL37) improved glucose tolerance due to enhancement of pancreatic beta cell glucose responsiveness and insulin secretion. PMID: 16181707
Both incretins secretion depends on mechanisms involving their own receptors and GLP-1 further requires GLUT2. PMID: 17681422
relative reduction of truncated GIPR expression may be involved in hypersensitivity of GIPR and hyperinsulinemia in diet-induced obese mice PMID: 17971513
Double incretin receptor knockout mice exhibit enhanced insulin action compared with wild-type mice when fed a regular diet and are protected from high-fat diet-induced obesity and insulin resistance. PMID: 17977951
Gastric inhibitory peptide receptor interacts with estrogens in the hypothalamic regulation of food intake in mice. PMID: 18505834
Results suggest that activation of the gastric inhibitory polypeptide receptor can improve diabetes control in high-fat-fed mice. PMID: 19073224
Analyses with GIPR-deficient mice suggest a role of GIP/GIPR signal transduction in promoting spontaneous recovery after nerve crush; injury of GIPR-deficient mouse sciatic nerve revealed impaired axonal regeneration. PMID: 19170165
Report differential importance of glucose-dependent insulinotropic polypeptide vs glucagon-like peptide 1 receptor signaling for beta cell survival in mice. PMID: 19766644

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.