Recombinant Mouse Galectin 3 Protein
Beta LifeScience
SKU/CAT #: BLA-1994P
Recombinant Mouse Galectin 3 Protein
Beta LifeScience
SKU/CAT #: BLA-1994P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Host Species | Mouse |
| Accession | P16110 |
| Synonym | 35 kDa lectin Carbohydrate binding protein 35 Carbohydrate-binding protein 35 CBP 35 CBP35 Gal-3 GAL3 Galactose-specific lectin 3 Galactoside-binding protein GALBP Galectin 3 internal gene,included Galectin-3 Galectin3 GALIG GBP IgE binding protein IgE-binding protein L 31 L 34 L-31 L-34 galactoside-binding lectin L31 Laminin-binding protein Lectin L-29 Lectin, galactose binding, soluble 3 LEG3_HUMAN LGALS2 LGALS3 MAC 2 antigen Mac-2 Mac-2 antigen MAC2 Macrophage galactose-specific lectin MGC105387 |
| Description | Recombinant Mouse Galectin 3 Protein was expressed in E.coli. It is a Full length protein |
| Source | E.coli |
| AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSMADSFSLNDALAGSGNPNPQGYPGAWG NQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSAYPGPTAP GAYPGPTAPGAYPGSTAPGAFPGQPGAPGAYPSAPGGYPAAGPYGVPAGP LTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRF NENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAV NDAHLLQYNHRMKNLREISQLGISGDITLTSANHAMI |
| Molecular Weight | 30 kDa including tags |
| Purity | >95% purity as determined by SDS-PAGE |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Bioactivity | The ED50 for this effect is -‰¤25 ug/ml. Measured by its ability to agglutinate human red blood cells |
| Formulation | Liquid Solution |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
| Target Function | Galactose-specific lectin which binds IgE. May mediate with the alpha-3, beta-1 integrin the stimulation by CSPG4 of endothelial cells migration. Together with DMBT1, required for terminal differentiation of columnar epithelial cells during early embryogenesis. In the nucleus: acts as a pre-mRNA splicing factor. Involved in acute inflammatory responses including neutrophil activation and adhesion, chemoattraction of monocytes macrophages, opsonization of apoptotic neutrophils, and activation of mast cells. Together with TRIM16, coordinates the recognition of membrane damage with mobilization of the core autophagy regulators ATG16L1 and BECN1 in response to damaged endomembranes. |
| Subcellular Location | Cytoplasm. Nucleus. Secreted. |
| Database References | STRING: 10090.ENSMUSP00000114350 UniGene: Mm.248615 |
| Tissue Specificity | The highest levels are found in activated macrophages. |
