Recombinant Mouse Ga-Binding Protein Alpha Chain (GABPA) Protein (GST)

Name: Recombinant Mouse Ga-Binding Protein Alpha Chain (GABPA) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-06668P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Ga-Binding Protein Alpha Chain (GABPA) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q00422
Target Symbol	GABPA
Synonyms	(GABP subunit alpha)
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MTKREAEELIEIEIDGTEKAECTEESIVEQTYTPAECVSQAIDINEPIGNLKKLLEPRLQCSLDAHEICLQDIQLDPDRSLFDQGVKTDGTVQLSVQVISYQGMEPKLNILEIVKTAETVEVVIDPDAHHAEAEAHLVEEAQVITLDGTKHITTISDETSEQVTRWAAALEGYRKEQERLGIPYDPIHWSTDQVLHWVVWVMKEFSMTDIDLTTLNISGRELCSLNQEDFFQRVPRGEILWSHLELLRKYVLASQEQQMNEIVTIDQPVQIIPASVPPATPTTIKVINSSAKAAKVQRSPRISGEDRSSPGNRTGNNGQIQLWQFLLELLTDKDARDCISWVGDEGEFKLNQPELVAQKWGQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVIECEQKKLARMQLHGIAQPVTAVALAATSLQADKEI
Expression Range	1-454aa
Protein Length	Full Length
Mol. Weight	78.0 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Transcription factor capable of interacting with purine rich repeats (GA repeats).
Subcellular Location	Nucleus.
Protein Families	ETS family
Database References	KEGG: mmu:14390 STRING: 10090.ENSMUSP00000009120 UniGene: PMID: 29051483 conditionally deleted Gabpa, the DNA-binding component of this transcription factor complex, from embryonic fibroblasts to examine the role of Gabp in mitochondrial biogenesis, function, and gene expression PMID: 24958105 Loss of Gabpalpha prevented development of CML, although mice continued to generate BCR-ABL-expressing Gabpalpha-null cells for months that were serially transplantable and contributed to all lineages in secondary recipients. PMID: 23345428 NRF-2 and NRF-1 operate in a concurrent and parallel manner in mediating the tight coupling between energy metabolism and neuronal activity at the molecular level. PMID: 23085505 Through genome-wide mapping of GABPalpha binding and transcriptomic analysis of GABPalpha-deficient HSCs, we identified Zfx and Etv6 transcription factors and prosurvival Bcl-2 family members including Bcl-2, Bcl-X(L), and Mcl-1 as direct GABP target genes. PMID: 21139080 Disruption of Gabpa was associated with a marked reduction in myeloid progenitor cells, and Gabpalpha null myeloid cells express reduced levels of the transcriptional repressor, Gfi-1. PMID: 21705494 chemical shift and secondary structure of the PNT/SAM domains PMID: 12449421 phosphorylation of threonine 280 in GABPalpha triggers reorganizations of the quaternary structure of GABP PMID: 14585962 Erralpha and GA-binding protein a partner with PGC-1alpha in muscle to form a double-positive-feedback loop that drives the expression of many oxidative phosphorylation genes PMID: 15100410 Gabpa function is essential and is not compensated for by other ETS transcription factors and is consistent with a specific requirement for Gabp expression for the maintenance of target genes involved in embryo essential mitochondrial cellular functions PMID: 15199140 GABP is essential for the regulation of IL-7Ralpha expression in T cells. PMID: 15361867 Binding of GABP to the GAA/CF6 bi-directional promoter provides the potential for autoregulation of GABP alpha expression and confirms the importance of GABP in the coordinate expression of respiratory chain components PMID: 16309857 GABPalpha upregulates the expression of Oct-3/4 via downregulation of Oct-3/4 repressors. PMID: 17194449 GABPalpha is necessary and sufficient for re-entry into the cell cycle and it regulates a pathway that is distinct from that of D-type cyclins and CDKs. PMID: 17277770 GABP transcription factor aids in the structural formation and function of neuromuscular junctions by regulating the expression of postsynaptic genes PMID: 17325042 Deficiency of GABPalpha, the DNA-binding subunit of GABP, resulted in profoundly defective B cell development and a compromised humoral immune response, in addition to thymic developmental defects. PMID: 17442597 These data indicate that GABP is dispensable for synapse-specific transcription and maintenance of normal acetylcholine receptor expression at synapses. PMID: 17485447 Because NRG-1 signaling is not expected to alter the function of the C-terminal region, which remains in these cells, these results suggest that GABPbeta, or other interacting components, rather than GABPalpha directly, is targeted by NRG-1 signaling. PMID: 17975830 Ther is a direct structural link between GABP and a central component of the transcriptional machinery. PMID: 18295234 Il7ra promoter acetylation and activity was dependent on the reciprocal binding of GABPalpha and Gfi-1. Data provide a biochemical mechanism for the generation of stable IL-7Ralpha(high) and IL-7Ralpha(low) states in virus-specific effector CD8 T cells. PMID: 18390712 functional relevance of the -119 GABP-binding site in the Robo4 promoter in vivo PMID: 18519813

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.