Recombinant Mouse Fmet-Leu-Phe Receptor (FPR1) Protein (His-GST&Myc)
Beta LifeScience
SKU/CAT #: BLC-02211P

Greater than 85% as determined by SDS-PAGE.
Recombinant Mouse Fmet-Leu-Phe Receptor (FPR1) Protein (His-GST&Myc)
Beta LifeScience
SKU/CAT #: BLC-02211P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Fmet-Leu-Phe Receptor (FPR1) Protein (His-GST&Myc) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P33766 |
Target Symbol | FPR1 |
Synonyms | Fpr1; fMet-Leu-Phe receptor; fMLP receptor; N-formyl peptide receptor; FPR; N-formylpeptide chemoattractant receptor |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-10His-GST&C-Myc |
Target Protein Sequence | MDTNMSLLMNKSAVNLMNVSGSTQSVSAGYIVLDV |
Expression Range | 1-35aa |
Protein Length | Partial |
Mol. Weight | 33.7 kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors. Binding of fMLP to the receptor stimulates intracellular calcium mobilization and superoxide anion release. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Receptor for TAFA4, mediates its effects on chemoattracting macrophages, promoting phagocytosis and increasing ROS release. |
Subcellular Location | Cell membrane; Multi-pass membrane protein. |
Protein Families | G-protein coupled receptor 1 family |
Database References | KEGG: mmu:14293 STRING: 10090.ENSMUSP00000052894 UniGene: PMID: 28466255 |