Recombinant Mouse Fibroblast Growth Factor 17 (FGF17) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05998P

Greater than 95% as determined by SDS-PAGE.
Recombinant Mouse Fibroblast Growth Factor 17 (FGF17) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05998P
Collections: All products, Buy cytokines, chemokines, and growth factors for research online, Explore high-quality enzymes for research and supplementation, Featured enzyme molecules, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins, Kinase
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Fibroblast Growth Factor 17 (FGF17) Protein (His), Active is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
Activity | The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is less than 3 ug/ml. |
Uniprotkb | P63075 |
Target Symbol | FGF17 |
Synonyms | Fgf17Fibroblast growth factor 17; FGF-17 |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | C-6His |
Complete Sequence | TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAERQKQFEFVGSAPTRRTKRTRRPQSQT |
Expression Range | 23-216aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 23.7 kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 1 mM EDTA, 1 mM DTT, pH 7.4 |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Target Details
Target Function | Plays an important role in the regulation of embryonic development and as signaling molecule in the induction and patterning of the embryonic brain. Required for normal brain development. |
Subcellular Location | Secreted. |
Protein Families | Heparin-binding growth factors family |
Database References | KEGG: mmu:14171 STRING: 10090.ENSMUSP00000022697 UniGene: PMID: 25889070 |