Recombinant Mouse Fanconi-Associated Nuclease 1 (FAN1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00657P

Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse Fanconi-Associated Nuclease 1 (FAN1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00657P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Fanconi-Associated Nuclease 1 (FAN1) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q69ZT1 |
Target Symbol | FAN1 |
Synonyms | (FANCD2/FANCI-associated nuclease 1)(mFAN1)(Myotubularin-related protein 15) |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | IHSAPAESLRAWVGEAWQAQQGRVASLVSWDRFTSLQQAQDLVSCLGGPVLSGVCRRLAADFRHCRGGLPDLVVWNSQSHHCKLVEVKGPSDRLSCKQMIWLYELQKLGADVEVCHVVAVGAKSKGLG |
Expression Range | 893-1020aa |
Protein Length | Partial |
Mol. Weight | 21.4 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Nuclease required for the repair of DNA interstrand cross-links (ICL) recruited at sites of DNA damage by monoubiquitinated FANCD2. Specifically involved in repair of ICL-induced DNA breaks by being required for efficient homologous recombination, probably in the resolution of homologous recombination intermediates. Not involved in DNA double-strand breaks resection. Acts as a 5'-3' exonuclease that anchors at a cut end of DNA and cleaves DNA successively at every third nucleotide, allowing to excise an ICL from one strand through flanking incisions. Probably keeps excising with 3'-flap annealing until it reaches and unhooks the ICL. Acts at sites that have a 5'-terminal phosphate anchor at a nick or a 1- or 2-nucleotide flap and is augmented by a 3' flap. Also has endonuclease activity toward 5'-flaps. |
Subcellular Location | Nucleus. |
Protein Families | FAN1 family |
Database References | KEGG: mmu:330554 STRING: 10090.ENSMUSP00000130012 UniGene: PMID: 29990673 |