Recombinant Mouse Epithelial Cell Adhesion Molecule (EPCAM) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01300P
Greater than 85% as determined by SDS-PAGE.
Recombinant Mouse Epithelial Cell Adhesion Molecule (EPCAM) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01300P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mouse Epithelial Cell Adhesion Molecule (EPCAM) Protein (His&Myc) is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q99JW5 |
| Target Symbol | EPCAM |
| Synonyms | Epithelial glycoprotein 314 Short name: EGP314 Short name: mEGP314 Protein 289A Tumor-associated calcium signal transducer 1 CD_antigen: CD326 |
| Species | Mus musculus (Mouse) |
| Expression System | Mammalian cell |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT |
| Expression Range | 24-266aa |
| Protein Length | Partial |
| Mol. Weight | 32.7 kDa |
| Research Area | Cell-Cell Adhesion |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E. |
| Subcellular Location | Lateral cell membrane; Single-pass type I membrane protein. Cell junction, tight junction. |
| Protein Families | EPCAM family |
| Database References | KEGG: mmu:17075 STRING: 10090.ENSMUSP00000061935 UniGene: PMID: 29958886 |
