Recombinant Mouse Ephrin-B3 (EFNB3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09681P
Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse Ephrin-B3 (EFNB3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09681P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mouse Ephrin-B3 (EFNB3) Protein (His) is produced by our Yeast expression system. This is a extracellular protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | O35393 |
| Target Symbol | EFNB3 |
| Synonyms | Efnb3Ephrin-B3 |
| Species | Mus musculus (Mouse) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | LSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPSYEFYKLYLVEGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSAEPGRDTIPGDPSSNATSRGAEGPLPPPSMPA |
| Expression Range | 28-227aa |
| Protein Length | Extracellular Domain |
| Mol. Weight | 24.0 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. May play a pivotal role in forebrain function. Binds to, and induce the collapse of, commissural axons/growth cones in vitro. May play a role in constraining the orientation of longitudinally projecting axons. |
| Subcellular Location | Membrane; Single-pass type I membrane protein. |
| Protein Families | Ephrin family |
| Database References | KEGG: mmu:13643 STRING: 10090.ENSMUSP00000004036 UniGene: PMID: 29901151 |
