Recombinant Mouse Elastin (ELN) Protein (His)

Name: Recombinant Mouse Elastin (ELN) Protein (His)
Brand: Beta LifeScience
SKU: BLC-05140P
Price: 680.8 USD
Availability: InStock

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Eln.

Collections: Antibody / cell therapy targets, Car-t cell therapy targets, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Elastin (ELN) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P54320
Target Symbol	ELN
Synonyms	ElnElastin; Tropoelastin
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-10His
Target Protein Sequence	PLGYPIKAPKLPGGYGLPYTNGKLPYGVAGAGGKAGYPTGTGVGSQAAAAAAKAAKYGAGGAGVLPGVGGGGIPGGAGAIPGIGGIAGAGTPAAAAAAKAAAKAAKYGAAGGLVPGGPGVRLPGAGIPGVGGIPGVGGIPGVGGPGIGGPGIVGGPGAVSPAAAAKAAAKAAKYGARG
Expression Range	266-443aa
Protein Length	Partial
Mol. Weight	21.3 kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Major structural protein of tissues such as aorta and nuchal ligament, which must expand rapidly and recover completely. Molecular determinant of the late arterial morphogenesis, stabilizing arterial structure by regulating proliferation and organization of vascular smooth muscle.
Subcellular Location	Secreted, extracellular space, extracellular matrix.
Protein Families	Elastin family
Database References	KEGG: mmu:13717 STRING: 10090.ENSMUSP00000015138 UniGene: Mm.275320

Gene Functions References

Data (including data from studies in mutant mice and cells from such mice) suggest that elastin-derived peptides are involved in regulation of lipid storage in hepatocytes; thus, elastin-derived peptides may play role in development and progression of non-alcoholic fatty liver. PMID: 29802129
Elastin insufficiency triggers structural defects and abnormal remodeling of renal vascular signaling involving AT1R-mediated vascular mechanotransduction and renal hyperfiltration with increased blood pressure sensitivity to dietary sodium contributing to systolic hypertension. PMID: 28754555
findings strongly suggested that elastin crosslinking and LOXL1 were co-associated with liver cirrhosis, while selective inhibition of LOXL1 arrested disease progression by reducing crosslinking of elastin. PMID: 29366776
Elastin-Derived Peptides Promote Abdominal Aortic Aneurysm Formation by Modulating M1/M2 Macrophage Polarization PMID: 27183603
mTOR-sensitive perturbation of smooth muscle cell mechanosensing contributes to elastin aortopathy. PMID: 28751568
Deficient circumferential growth is the predominant mechanism for moderate obstructive aortic disease resulting from partial elastin deficiency in Williams syndrome. PMID: 28254817
Elevations of whole lung HMGB1 level were associated with impaired alveolar development and aberrant elastin production in 85% O2-exposed newborn lungs. PMID: 26982166
Eln was ubiquitously present, with enrichment in regions with cardiomyocyte differentiation, while there was an inverse correlation between ColI and cardiomyocyte differentiation. PMID: 25923353
Lung histology revealed aberrant elastin production and impaired lung septation in oxygen-exposed lungs, while tropoelastin, integrin alphav, fibulin-1, fibulin-2 and fibulin-4 gene expression were elevated. PMID: 25428696
Data suggest that expression of elastin in uterus, vagina, and bladder is down-regulated both in naturally aging mice and in mouse model of accelerated ovarian aging; such down-regulation may lead to pelvic floor disorders. PMID: 25131766
These results suggest that elastin haploinsufficiency adversely impacts pulmonary angiogenesis. PMID: 25539853
The increased levels of elastin, type V collagen and tenascin C are probably the result of increased expression by fibroblastic cells; reversely, elastin influences myofibroblast differentiation. PMID: 24291458
Compared to control SMCs, the modulus of Eln-/- SMCs is reduced by 40%, but is unchanged in Fbln4-/- SMCs. The Eln-/- SMC modulus is rescued by soluble or alpha elastin treatment. PMID: 24322348
Elastin haploinsufficiency impedes the progression of arterial calcification in MGP-deficient mice. PMID: 23857752
Fstl1 is crucial for elastin expression and deposition in mesenchyme during lung alveologenesis PMID: 24282586
Eln insufficiency induced hypertension is due to increased sensitivity of the resistance vasculature to circulating ANG II and to impaired endothelium-dependent vasodilatation. PMID: 24414067
Two sides of MGP null arterial disease: chondrogenic lesions dependent on transglutaminase 2 and elastin fragmentation associated with induction of adipsin. PMID: 24036114
tested the hypothesis that adhesive strength varies with atherosclerotic plaque composition of collagen and elastin in apoE and MMP12 knock outs PMID: 23261250
Data show that tropoelastin staining was relatively weak in the ligamentum flavum from E15 through P0, P7 was the first stage that staining intensity was observed to be substantially stronger, intensity remained relatively high until P35. PMID: 22685574
the C-terminal region of tropoelastin in has a critical role in elastic fiber assembly and suggest tissue-specific differences in the elastin assembly pat PMID: 22573328
Macrophage-derived macrophage metalloelastase-12 regulates elastin degradation even in progressive experimental liver fibrosis. PMID: 22223197
Genetic modifiers of cardiovascular phenotype caused by elastin haploinsufficiency act by extrinsic noncomplementation. PMID: 22049077
Report accelerated fatigue-induced damage to or protease-related degradation of initially competent elastic elastin fibres in fibrillin-1 deficiency that renders arteries in Marfan syndrome increasingly susceptible to dilatation, dissection, and rupture. PMID: 21730037
MMP-12 leads to elastin degradation in eosinophilic meningitis caused by Angiostrongylus cantonensis. PMID: 21856305
Eln(+/-) mice have decreased aortic diameter and compliance in ex vivo tests that are significant by postnatal day 7 PMID: 21536846
miR-29 and miR-15 family miRNAs are involved in the down-regulation of elastin in the adult aorta. PMID: 21305018
Elastin degradation might be necessary but is not sufficient to induce arterial medial calcification. PMID: 21281809
TGF-beta suppresses elastin degradation by inhibiting plasmin-mediated matrix metalloproteinase 9 activation. PMID: 21356372
Oxidative and nitrosative modifications of tropoelastin prevent elastic fiber assembly. PMID: 20847053
Elastin insufficiency in a mouse model establishes a role for elastin dysregulation in aortic valve pathogenesis. PMID: 20576933
Elastin is only necessary for normal cardiovascular structure and function in mice starting in the last few days of fetal development. PMID: 20495146
Data show that elastin induces actin stress fiber organization, inhibits proliferation, regulates migration and signals via a non-integrin, heterotrimeric G-protein-coupled pathway. PMID: 12466207
tropoelastin has domains that mediate elastin deposition in vitro and in vivo PMID: 12626514
Coordinately expressed and regulated with fibulin 5 in lung fibroblasts and may serve a key role during lung injury and repair. PMID: 12909585
elastin gene product, signaling through the VGVAPG domain, directly induces VSMC myofibrillogenesis PMID: 14614988
The mechanical behavior of ELN(+/-) arteries is likely due to the reduced elastin content combined with adaptive remodeling during vascular development PMID: 15863465
Low levels of elastin is associated with pulmonary emphysema PMID: 17142349
developed humanized elastin mouse with elastin production controlled by human elastin gene in bacterial artificial chromosome; expression pattern of human transgene mirrors endogenous murine gene PMID: 17626896
Enhanced generation of elastin peptides in S100A4/Mts1 mice may promote increased viral entry in the vessel wall. PMID: 18083765
Early elastin expression and organization modify arterial aging through their impact on both vascular cell physiology and structure. PMID: 18173368
In MMP-9-deficient animals, vascular inflammation continued to develop, but the incidence of elastin breakdown was significantly reduced. Elastin breakdown in the coronary artery was virtually eliminated by ablation of MMP-9 PMID: 18311803
LOXL1-KO lower urogenital tract anatomical and functional phenotype resembles female pelvic floor dysfunction in humans. Elastin disorganization may lead to such functional abnormalities. PMID: 18495804
At atherosclerosis-susceptible vascular branch points, the absence of a luminal elastin barrier and the presence of a dense collagen/proteoglycan matrix contribute to increased retention of LDL PMID: 18506002
Elastin insufficiency predisposes to elevated pulmonary circulatory pressures through changes in elastic artery structure. PMID: 18772328
Reduced elastin in mice leads to adaptive remodeling, whereas the complete lack of elastin leads to pathological remodeling and death. PMID: 19372465

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.