Recombinant Mouse E3 Ubiquitin-Protein Ligase Ubr1 (UBR1) Protein (His&His)
Beta LifeScience
SKU/CAT #: BLC-06400P

Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse E3 Ubiquitin-Protein Ligase Ubr1 (UBR1) Protein (His&His)
Beta LifeScience
SKU/CAT #: BLC-06400P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse E3 Ubiquitin-Protein Ligase Ubr1 (UBR1) Protein (His&His) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | O70481 |
Target Symbol | UBR1 |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-6His&C-6His |
Target Protein Sequence | CILCQEEQEVKLENNAMVLSACVQKSTALTQHRGKPVDHLGETLDPLFMDPDLAHGTYTGSCGHVMHAVCWQKYFEAVQLSSQQRIHVDLFDLESGEYLCPLCK |
Expression Range | 1101-1204aa |
Protein Length | Partial |
Mol. Weight | 16.6 kDa |
Research Area | Cell Biology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation. May be involved in pancreatic homeostasis. Binds leucine and is a negative regulator of the leucine-mTOR signaling pathway, thereby controlling cell growth. |
Subcellular Location | Cytoplasm, cytosol. |
Protein Families | UBR1 family |
Database References | KEGG: mmu:22222 STRING: 10090.ENSMUSP00000028728 UniGene: PMID: 12882367 |