Recombinant Mouse Disintegrin And Metalloproteinase Domain-Containing Protein 12 (ADAM12) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-02512P
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Baculovirus-expressed Mus musculus (Mouse) Adam12.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Baculovirus-expressed Mus musculus (Mouse) Adam12.
Recombinant Mouse Disintegrin And Metalloproteinase Domain-Containing Protein 12 (ADAM12) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-02512P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mouse Disintegrin And Metalloproteinase Domain-Containing Protein 12 (ADAM12) Protein (His&Myc) is produced by our Baculovirus expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q61824 |
| Target Symbol | ADAM12 |
| Synonyms | Adam12; MltnaDisintegrin and metalloproteinase domain-containing protein 12; ADAM 12; EC 3.4.24.-; Meltrin-alpha |
| Species | Mus musculus (Mouse) |
| Expression System | Baculovirus |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | ETLKMTKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDIDKCSISQDPFTSLHEFLDWRKIKLLPRKSHDNAQLISGVYFQGTTIGMAPIMSMCTAEQSGGVVMDHSDSPLGAAVTLAHELGHNFGMNHDTLERGCSCRMAAEKGGCIMNPSTGFPFPMVFSSCSRKDLEASLEKGMGMCLFNLPEVKQAFGGRKCGNGYVEEGEECDCGEPEECTNRCCNATTCTLKPDAVCAHGQCCEDCQLKPPGTACRGSSNSCDLPEFCTGTAPHCPANVYLHDGHPCQGVDGYCYNGICQTHEQQCVTLWGPGAKPAPGICFERVNSAGDPYGNCGKDSKSAFAKCELRDAKCGKIQCQGGASRPVIGTNAVSIETNIPQQEGGRILCRGTHVYLGDDMPDPGLVLAGTKCAEGKICLNRRCQNISVFGVHKCAMQCHGRGVCNNRKNCHCEAHWAPPFCDKFGFGGSTDSGPIRQADNQG |
| Expression Range | 206-706aa |
| Protein Length | Partial |
| Mol. Weight | 58.4kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Involved in skeletal muscle regeneration, specifically at the onset of cell fusion. Also involved in macrophage-derived giant cells (MGC) and osteoclast formation from mononuclear precursors. |
| Subcellular Location | Membrane; Single-pass type I membrane protein. |
| Database References | KEGG: mmu:11489 STRING: 10090.ENSMUSP00000065213 UniGene: PMID: 28637396 |
