Recombinant Mouse Dexamethasone-Induced Ras-Related Protein 1 (RASD1) Protein (His)

Name: Recombinant Mouse Dexamethasone-Induced Ras-Related Protein 1 (RASD1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-00408P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Dexamethasone-Induced Ras-Related Protein 1 (RASD1) Protein (His) is produced by our Baculovirus expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	O35626
Target Symbol	RASD1
Species	Mus musculus (Mouse)
Expression System	Baculovirus
Tag	N-10His
Target Protein Sequence	MKLAAMIKKMCPSDSELSIPAKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLKQQILDTKSCLKNKTKENVDVPLVICGNKGDRDFYREVEQREIEQLVGDDPQRCAYFEISAKKNSSLDQMFRALFAMAKLPSEMSPDLHRKVSVQYCDVLHKKALRNKKLLRAGSGGGGDHGDAFGILAPFARRPSVHSDLMYIREKTSVGSQAKDKERCVIS
Expression Range	1-280aa
Protein Length	Full Length
Mol. Weight	34.2 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Small GTPase. Negatively regulates the transcription regulation activity of the APBB1/FE65-APP complex via its interaction with APBB1/FE65.
Subcellular Location	Cell membrane; Lipid-anchor; Cytoplasmic side. Cytoplasm, perinuclear region. Nucleus.
Protein Families	Small GTPase superfamily, RasD family
Database References	KEGG: mmu:19416 STRING: 10090.ENSMUSP00000051959 UniGene: PMID: 27345868 These findings suggest that RASD1 acts as a novel signaling molecule and plays an important role in regulating dynamic uterine remodeling during the estrous cycle in the uterus. PMID: 28188843 This study demonstrated that provide unprecedented evidence for a selective epigenetic up-regulation of Dexras 1 gene expression in the striatum of EAE mice. PMID: 27138096 RASD1 is a novel factor in Metaphase I-Metaphase II oocyte transition and may be involved in regulating the progression of cytokinesis and spindle formation PMID: 27997888 Results suggest a potential role for Dexras1 in modulating a selective subset of psychiatric symptoms, possibly via its interaction with NMDARs and/or other disease-related binding-partners PMID: 26946266 two mechanisms of Rasd1 induction in the hypothalamus, were identified. PMID: 26739966 Lysosomal iron modulates NMDA receptor-mediated excitation via small GTPase, Dexras1 PMID: 27080392 Dexras1 mediates adipogenesis and diet-induced obesity. PMID: 24297897 Dexras1 is involved in the circadian clock regulation PMID: 23703963 Dexras1 appears to mediate N-methylaspartate (NMDA)-elicited neurotoxicity via nitric oxide and iron influx. PMID: 23426685 These results indicate that the absence of Dexras1 sensitizes the suprachiasmatic nucleus to perturbations resulting from restricted feeding. PMID: 22928915 Data suggest that Dexras1 regulates multiple photic and nonphotic signal-transduction pathways, thereby playing an essential role modulating species-specific characteristics of circadian entrainment. PMID: 21834641 Rasd1 modulates endogenous renin gene expression by interacting with Ear2. PMID: 21247419 the Dexamethasone-induced RAS protein 1 (Dexras1) gene is a cycling gene in the suprachiasmatic nucleus PMID: 12573527 Genetic deletion of Dexras1 reduces photic entrainment by eliminating a pertussis-sensitive circadian response to NMDA. Mechanistically, Dexras1 couples NMDA and light input to Gi/o and ERK activation. In PMID: 15339652 dexras1 was found to change rhythmically in hypothalamic and extra-hypothalamic brain regions reaching peak levels early in the light phase. PMID: 16517089 We demonstrate that Rasd1 mRNA is expressed in mouse lymph node cells in response to inhibitory stimuli. Rasd1 mRNA is present at low levels in freshly isol. cells, but it is up-regulated in culture and is expressed in cells whose proliferation is blocked PMID: 17369188

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.