Recombinant Mouse Dedicator Of Cytokinesis Protein 8 (DOCK8) Protein (His)

Name: Recombinant Mouse Dedicator Of Cytokinesis Protein 8 (DOCK8) Protein (His)
Brand: Beta LifeScience
SKU: BLC-11236P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Mouse Dedicator Of Cytokinesis Protein 8 (DOCK8) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q8C147
Target Symbol	DOCK8
Synonyms	Dock8Dedicator of cytokinesis protein 8
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	KSYQASPDLRLTWLQNMAEKHTKKKCFTEAAMCLVHAAALVAEYLSMLEDHSYLPVGSVSFQNISSNVLEESAVSDDTLSPDEDGVCSGRYFTESGLVGLLEQAAELFSTGGLYETVNEVYKLVIPILEAHRDFRKLTSTHDKLQKAFDNIINKDHKRMFGTYFRVGFYGSRFGDLDEQEFVYKEPAITKLPEISHRLEGFYGQCFGAEFVEVIKDSTPVDKTKLDPNKAYIQITFVEPYFDEYEMKDRVTYFEKNFNLRRFMYTTPFTLEGRPRGELHEQHRRNTVLTTMHAFPYIKTRIRVSQKEEFVLTPIEVAIEDMKKKTLQLAVATHQEPPDAKMLQMVLQGSVGATVNQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNRRLITAEQREYQQELKKNYNKLRDSLRPMIERKIP
Expression Range	1633-2067aa
Protein Length	Partial
Mol. Weight	55.8 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Guanine nucleotide exchange factor (GEF) which specifically activates small GTPase CDC42 by exchanging bound GDP for free GTP. During immune responses, required for interstitial dendritic cell (DC) migration by locally activating CDC42 at the leading edge membrane of DC. Required for CD4(+) T-cell migration in response to chemokine stimulation by promoting CDC42 activation at T cell leading edge membrane. Is involved in NK cell cytotoxicity controlling polarization of microtubule-organizing center (MTOC), and possibly regulating CCDC88B-mediated lytic granule transport to MTOC during cell killing.
Subcellular Location	Cytoplasm. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cell projection, lamellipodium membrane; Peripheral membrane protein; Cytoplasmic side.
Protein Families	DOCK family
Database References	KEGG: mmu:76088 STRING: 10090.ENSMUSP00000025831 UniGene: Mm.102485
Tissue Specificity	Expressed in T cells. Expressed in bone marrow-derived dendritic cells.

Gene Functions References

DOCK8 and WASp are in the same signaling pathway that links T-cell receptors (TCRs) to the actin cytoskeleton in TCR-driven actin assembly. PMID: 27599296
LRCH1 as a novel effector to restrain PKCalpha-DOCK8-Cdc42 module-induced T cell migration and ameliorate experimental autoimmune encephalomyelitis (EAE). PMID: 28028151
DOCK8-deficient mice have poor control of primary cutaneous herpes simplex lesions and this is associated with increased virus loads. Furthermore, DOCK8-deficient mice showed a lack of CD4(+) T-cell infiltration into HSV-infected skin. PMID: 25776845
DOCK8 expression in the haematopoietic compartment is required for protective immunity and its deficiency results in drastic reduction of RORgammat+ innate lymphoid cells in the GI tract PMID: 25091235
conclude that DOCK8 is an important regulator of DC migration during an immune response and is prone to mutations that disrupt its crucial function PMID: 25713392
DOCK8-regulated shape integrity of lymphocytes prevents cytothripsis and promotes antiviral immunity in the skin. PMID: 25422492
DOCK8 is required for the development and survival of mature NKT cells. PMID: 23929855
DOCK8 regulates interstitial DC migration by controlling Cdc42 activity spatially. PMID: 22461490
Characterisation of the DOCK8-deficient mouse revealed T-cell lymphopenia, with increased T-cell turnover and decreased survival. PMID: 21969276
These findings highlight a key role for DOCK8 in the survival and function of human and mouse CD8 T cells. PMID: 22006977
Mutation of the DOCK8 protein in mice has profound effects on humoral immunity with a failure to sustain the antibody response and failure of germinal center B cell persistence. (Review) PMID: 21178273
Humoral immunodeficiency due to Dock8 mutation provides evidence that organization of the immunological synapse is critical for signaling the survival of B cell subsets required for long-lasting immunity. PMID: 19898472

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.