Recombinant Mouse Cytochrome P450 3A11 (CYP3A11) Protein (His&Myc)

Name: Recombinant Mouse Cytochrome P450 3A11 (CYP3A11) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-06941P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Mouse Cytochrome P450 3A11 (CYP3A11) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q64459
Target Symbol	CYP3A11
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	MDLVSALSLETWVLLAISLVLLYRYGTRKHELFKKQGIPGPKPLPFLGTVLNYYKGLWKFDMECYKKYGKTWGLFDGQTPLLAVTDPETIKNVLVKECFSVFTNRRDFGPVGIMSKAISISKDDEWKRYRALLSPTFTSGKLKEMFPVIEQYGDILVKYLRQKAKKGKPVTMKDVLGAYSMDVITSTSFGVNVDSLNNPEDPFVEKAKKLLRFDFFDPLLFSVVLFPFLTPVYEMLNICMFPKDSIEFFKKFVDRMKESRLDSKQKHRVDFLQLMMNSHNNSKDKVSHKALSDMEITAQSIIFIFAGYETTSSTLSFTLHSLATHPDIQKKLQDEIDEALPNKAPPTYDTVMEMEYLDMVLNETLRLYPIANRLERVCKKDVELNGVYIPKGSTVMIPSYALHHDPQHWSEPEEFQPERFSKENKGSIDPYVYLPFGNGPRNCLGMRFALMNMKLALTKIMQNFSFQPCKETQIPLKLSRQGLLQPEKPIVLKVVPRDAVITGA
Expression Range	1-504aa
Protein Length	Full Length
Mol. Weight	65.3 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Catalyzes erythromycin N-demethylation, nifedipine oxidation and testosterone 6 beta-hydroxylation.
Subcellular Location	Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein.
Protein Families	Cytochrome P450 family
Database References	KEGG: mmu:13112 STRING: 10090.ENSMUSP00000037665 UniGene: Mm.332844
Tissue Specificity	Highly expressed in liver.

Gene Functions References

In het mice, RIF had no effect on plasma lipids composition, CYP27A1 activity, and atherosclerotic plaque development, despite a reduction in cholesterol absorption. In conclusion, the antiatherogenic effect of Cyp3a11 induction by RIF was also dependent on Cyp27a1 expression. PMID: 29191818
lack of Cyp3a has a positive effect on acclimation to a high-fat diet in females as it improves weight gain, glucose response and ketosis. PMID: 29738703
the interactions of quercetin and naringenin with CYP1A and CYP3A in mice liver were not affected by the levels of persistent organic pollutants exposure. PMID: 28567424
Cyp3a is a major determinant of systemic levels of testosterone in mice. PMID: 27137100
Diabetes mellitus caused a decrease in the activity of Cyp3a11-mediated testosterone-6beta-hydroxylation, but no change in the activity of Cyp3a11-mediated midazolam 1-hydroxylation and an increase in the activity of UGT1a9-mediated propofol O-glucuronidation in db/db mice PMID: 27514509
Data (including data from studies using recombinant enzymes/knockout mice) suggest that Cyp3a/Cyp3a11 is primary enzyme in liver microsomes contributing to formation of aldehydes during metabolic inactivation of gefitinib, an antineoplastic agent. PMID: 26212543
The validity of the in vivo model using transgenic mice carrying the human CYP3A4 gene and lacking their own Cyp3a genes (CYP3A4-Tg mice). PMID: 25005602
MC downregulates mouse hepatic CYP3A protein. PMID: 23846873
The findings suggest that reduction of hepatic total cholesterol in Cyp3a(-/-) mice would be the consequence of enhanced bile acid synthesis. PMID: 23709690
CYP3A expression level in the liver is not affected by the intake of a high-fat diet. PMID: 23370405
CYP3A is involved in limiting paclitaxel plasma concentrations after oral administration in mice. PMID: 23090875
Expression of Cyp3a11 was suppressed in hypothyroid C57BL/6 wild type (WT) mice and a further decrement was observed in hypothyroid CAR-/- mice, but not in hypothyroid PXR-/- mice PMID: 22503787
CYP3A activities in transgenic mice were markedly reduced compared to those in wild-type or unrelated miR-shRNA transgenic controls. PMID: 22291988
investigation of substrate specificity of Cyp3a using metabolomics approach: atazanavir is metabolized in vivo to same metabolites as via human recombinant CYP3A; identification of metabolites in mouse urine and feces PMID: 21148252
A deletion of the hepatocyte nuclear factor-4alpha binding motif in liver changes the expression of Cyp3a11. PMID: 20926756
Predominantly neuronal expression of cytochrome P450 isoforms CYP3A11 and CYP3A13 in mouse brain. PMID: 12617959
CYP3a expression is regulated by histidine decarboxylase PMID: 14642533
PXR is involved in induction of drug metabolism through its targeted genes including CYP3A4. PMID: 17936928
Drug metabolizing enzyme induction of Cyp3a11 is reported in experimental fatty liver. PMID: 18488193
Dynamic patterns of histone methylation are associated with ontogenic expression of the Cyp3a genes during mouse liver maturation. PMID: 19188337
Cyp3a11 plays a crucial role in directing drug action to hormonal response within the limbic system of mouse brain in drug-hormone crosstalk. PMID: 19226368

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.