Recombinant Mouse Cystathionine Beta-Synthase (CBS) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-08111P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Mouse Cystathionine Beta-Synthase (CBS) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-08111P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Mouse Cystathionine Beta-Synthase (CBS) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb Q91WT9
Target Symbol CBS
Synonyms Cbs; Cystathionine beta-synthase; EC 4.2.1.22; Beta-thionase; Serine sulfhydrase
Species Mus musculus (Mouse)
Expression System E.coli
Tag N-6His-SUMO
Target Protein Sequence PSGTSQCEDGSAGGFQHLDMHSEKRQLEKGPSGDKDRVWIRPDTPSRCTWQLGRAMADSPHYHTVLTKSPKILPDILRKIGNTPMVRINKISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGNLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDDTAEEILQQCDGKLDMLVASAGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEVEGIGYDFIPTVLDRAVVDKWFKSNDEDSFAFARMLIAQEGLLCGGSSGSAMAVAVKAARELQEGQRCVVILPDSVRNYMSKFLSDKWMLQKGFMKEELSVKRPWWWRLRVQELSLSAPLTVLPTVTCEDTIAILREKGFDQAPVVNESGAILGMVTLGNMLSSLLAGKVRPSDEVCKVLYKQFKPIHLTDTLGTLSHILEMDHFALVVHEQIQSRDQAWSGVVGGPTDCSNGMSSKQQMVFGVVTAIDLLNFVAAREQTQT
Expression Range 2-561aa
Protein Length Full Length of Mature Protein
Mol. Weight 77.4kDa
Research Area Others
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Hydro-lyase catalyzing the first step of the transsulfuration pathway, where the hydroxyl group of L-serine is displaced by L-homocysteine in a beta-replacement reaction to form L-cystathionine, the precursor of L-cysteine. This catabolic route allows the elimination of L-methionine and the toxic metabolite L-homocysteine. Also involved in the production of hydrogen sulfide, a gasotransmitter with signaling and cytoprotective effects on neurons.
Subcellular Location Cytoplasm. Nucleus.
Protein Families Cysteine synthase/cystathionine beta-synthase family
Database References

KEGG: mmu:12411

STRING: 10090.ENSMUSP00000066878

UniGene: PMID: 28774789

  • results suggested that reduced cystathionine beta-synthase/hydrogen sulfide AMP-activated protein kinase (CBS-H2S-AMPK) cascade activity contributed to microglia-mediated neuroinflammation following stroke. PMID: 28751019
  • Results indicate that activation of the cystathionine-beta-synthase (CBS) and its product hydrogen sulfide (CBS/H2S axis promotes colon carcinogenesis. PMID: 28923859
  • showed that N-homocysteinylation of collagen in Cbs(-/-) mice impairs its cross-linking PMID: 27530978
  • the findings of this study indicate that a deficiency in 3MST does not significantly affect endotoxemia, while a deficiency in CBS or CSE slightly ameliorates the outcome of LPS-induced endotoxemia in vivo. PMID: 27748832
  • These data confirm a key role for the H2S-generating enzymes Cbs and Cth in pulmonary vascular development and homeostasis and in lung alveolarization. PMID: 26232299
  • genetic deficiency results in reduced Tet1 and Tet2 expression, which leads to hypermethylation of Foxp3, and impairment of Treg cell differentiation and immune homeostasis. PMID: 26275994
  • Elevated homocytsteine levels in the CBS-/+ mouse skeletal muscles caused diminished anti-oxidant capacity and contributed to enhanced total protein as well as PGC-1alpha specific nitrotyrosylation after ischemia. PMID: 25608649
  • CBS disruption causes embryo retention and developmental delay in the mouse oviduct. PMID: 24914509
  • CBS is present in adrenocortical cells and accounts for H2S generation in adrenal glands. CBS is critical for maintenance of mitochondrial function and glucocorticoid production in adrenal cortex. PMID: 24702258
  • Elevating endogenous H2S via CBS over-expression in immortalized microglia not only reduced the expression of pro-inflammatory M1 genes, but also enhanced the anti-inflammatory M2 marker IL-10 production. PMID: 25086357
  • Cbs protein expression is upregulated in brain cortex following traumatic brain injury. PMID: 23315129
  • Brain of mice heterozygous for Cbs displays overexpression of DYR kinase and SAH hydrolase. PMID: 22700376
  • These findings set the stage to investigate the role of CBS and the transsulfuration pathway in the generation of GSH in mouse retina. PMID: 23470016
  • Hydrogen sulfide in the cortex and hippocampus exhibited dynamic changes after brain injury, in parallel with CBS mRNA and protein expression PMID: 23325453
  • Lanthionine synthetase C-like protein 1 interacts with and inhibits cystathionine beta-synthase: a target for neuronal antioxidant defense. PMID: 22891245
  • Cystathionine beta-synthase deficiency causes infertility by impairing decidualization and gene expression networks in uterus implantation sites. PMID: 22617046
  • Severe hyperhomocysteinemia promotes bone marrow-derived and resident inflammatory monocyte differentiation and atherosclerosis in LDLr/CBS-deficient mice. PMID: 22628578
  • A survey of hemostatic and hemodynamic parameters revealed no detectible differences between control and Tg-I278T Cbs(-/-) mice. PMID: 22186991
  • Results show that lack of CBS activity causes loss of fat mass, and that this effect appears to be independent of low serum tCys PMID: 22096601
  • cbs is a primary 1,25-dihydroxyvitamin D(3)[1,25(OH)(2) D(3)- target gene which renders homocyeteine metabolism responsive to 1,25(OH)(2) D(3). PMID: 21898591
  • Hyperhomocysteinemia impaired nitric oxide and endothelium-derived hyperpolarizing factor (EDHF) - mediated, endothelium-dependent relaxations of small mesenteric arteries in transgenic cystathionine beta synthase-deficient mice.[EDHF] PMID: 21653942
  • cystathionine beta-synthase activity partially regulates endogenous H(2)S PMID: 20955694
  • CBS expression is under dietary control; CBS is down-regulated within a few days upon initiation of methionine-deficient diet; such regulation is post-transcriptional in nature. PMID: 20036517
  • The effects of CBS AND CSE gene transfer on the homocysteine-mediated inflmmation of mesangial cells induced by hydrogen sulfide and MCP-1 and MIP-2 induction are reported. PMID: 20943958
  • We report here the generation of a new mouse model of classical homocystinuria in which the mouse cbs gene is inactivated and that exhibits low-level expression of the human CBS transgene under the control of the human CBS promoter PMID: 20638879
  • birth incidence of cbs (-/-) mice produced from heterozygous crosses is non-Mendelian and not significantly improved by treatment with either the Hcy lowering compound betaine or the cysteine donor N-acetylcysteine. PMID: 20638882
  • Cysteinemia, rather than homocysteinemia, is associated with plasma apolipoprotein A-I levels in hyperhomocysteinemia: lipid metabolism in cystathionine beta-synthase deficiency. PMID: 20537649
  • cystathionine beta-synthase has a role in hepatic steatosis through abnormal lipid metabolism PMID: 15466479
  • active CBS is essential for the formation of cysteinylated plasma albumin (CysAlb) PMID: 15555590
  • hyperhomocysteinemia in liver of CBS-deficient mice promotes oxidative stress, which may cause mitochondrial damage in association with activation of hepatic stellate cells, leading to liver injury PMID: 15887121
  • cystathionine beta-synthase plays a crucial role in the development and maintenance of the central nervous system PMID: 16160063
  • Caerulein decreased the level of cystathionine beta-Synthase. PMID: 17488480
  • Role of myofibroblasts differentiation in case of lung fibrosis due to CBS deficiency in mice. PMID: 17543941
  • Cystathionine beta synthase secreted by granulosa cells is necessary for oocyte maturation. PMID: 17561372
  • There was good CBS activity in the liver and cerebellum of the mouse but no activity in the retina. PMID: 17853447
  • Transfection of endothelial cells with CBS gene construct reduced homocysteine accumulation in high methionine-fed cells. PMID: 17855772
  • Cystathionine beta-synthase played essential roles in the central nervous system function and cysteine biosynthesis. PMID: 18364386
  • Double heterozygous mice lacking one allele of Cbs and Apoa1 develop hyperhomocysteinemia and hypoalphalipoproteinemia together with moderate hypertension. PMID: 18508577
  • cystathionine beta synthase deficiency initiates redox disequilibrium in the liver PMID: 18541157
  • The effects of different degrees of Cbs deficiency on hyperhomocysteinemia symptoms are reported. PMID: 18987302
  • Left ventricular hypertrophy was exaggerated in double knockout, and mildly increased in the CBS-/+, compared to WT mice PMID: 19021146
  • Results collected from metabolome analyses suggested that CBS serves as a CO-sensitive modulator of H(2)S to support biliary excretion. PMID: 19085910
  • hyperhomocysteinemia promotes differentiation of inflammatory monocyte subsets and their accumulation in atherosclerotic lesions via NAD(P)H oxidase-mediated oxidant stress in CBS deficiency PMID: 19858416
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed