Recombinant Mouse Corticoliberin (CRH) Protein (His-KSI)

Beta LifeScience SKU/CAT #: BLC-00573P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Mouse Corticoliberin (CRH) Protein (His-KSI)

Beta LifeScience SKU/CAT #: BLC-00573P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Mouse Corticoliberin (CRH) Protein (His-KSI) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb Q8CIT0
Target Symbol CRH
Synonyms (Corticotropin-releasing factor)(CRF)(Corticotropin-releasing hormone)
Species Mus musculus (Mouse)
Expression System E.coli
Tag N-6His-KSI
Target Protein Sequence SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII
Expression Range 145-185aa
Protein Length Full Length of Mature Protein
Mol. Weight 20.1 kDa
Research Area Others
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Hormone regulating the release of corticotropin from pituitary gland. Induces NLRP6 in intestinal epithelial cells, hence may influence gut microbiota profile.
Subcellular Location Secreted.
Protein Families Sauvagine/corticotropin-releasing factor/urotensin I family
Database References

KEGG: mmu:12918

STRING: 10090.ENSMUSP00000061185

UniGene: PMID: 27306314

  • Mice lacking corticotropin-releasing hormone, had an improved ability to escape away from potentially dangerous situations. PMID: 28786031
  • our results suggest an inhibitory role of miR-212 on the HPA axis, which acts in a counter-regulatory manner. PMID: 28912247
  • Study shows that prolactin was sufficient to suppress corticotrophin-releasing hormone (CRH) mRNA expression in the paraventricular nucleus, however it does not appear to be required for the ongoing regulation of the CRH neurones in lactation. PMID: 28744978
  • Study blocked endogenous CRH using 2 chemically distinct antagonists of the principal hippocampal CRH receptor, CRHR1. The antagonists caused a modest reduction of spontaneous excitatory transmission onto CA3 pyramidal cells, mediated. This was accompanied by a decrease in incidence but not amplitude of sharp waves, indicating that CRH synaptic actions are sufficient to alter the output of a complex hippocampal network. PMID: 28460009
  • Mice exposed to aggressive confrontations exhibited a similar pattern of species-typical aggressive and non-aggressive behaviors on the first and the last session. Repeated aggressive confrontations promoted an increase in plasma corticosterone. After 10 aggressive confrontation sessions, mice presented a non-significant trend toward reducing hippocampal levels of CRF, which inversely correlated with plasma corticosterone PMID: 28614436
  • Data (including data from studies in transgenic mice) suggest that Crh alters Gnrh neuron activity and that estradiol is required for Crh to exert both stimulatory and inhibitory effects on Gnrh neurons. (Crh = corticotropin-releasing hormone; Gnrh = gonadotropin releasing hormone) PMID: 29069304
  • The activation of parvalbumin(+) interneurons during morphine withdrawal was crucial for the induction of the negative emotion and the up-regulation of CRH mRNA levels in the central amygdala. PMID: 27385383
  • Psychological stress-derived CRF can breach the established endotoxin tolerance in the intestinal mucosa. PMID: 23840363
  • CRF plays a marked anxiogenic role at CRF1 receptors in the amygdala of mice exposed to the Elevated plus maze. PMID: 27060334
  • GABAA receptor (GABAAR) and the Na(+)-K(+)-2Cl(-) cotransporter (NKCC1), but not the K(+)-Cl(-) cotransporter (KCC2), were expressed in the terminals of the CRH neurons at the median eminence (ME). In contrast, CRH neuronal somata were enriched with KCC2 but not with NKCC1. PMID: 27540587
  • Excitability of genetically isolated CRF-receptive (CRFR1) neurons in the central nucleus of the amygdala (CeA) is potently enhanced by CRF and that CRFR1 signaling in the CeA is critical for discriminative fear PMID: 28017470
  • activation of the Gq-membrane-associated estrogen receptors rapidly stimulates hypothalamic paraventricular nucleus CRH neurons by suppressing the M-current and potentiating glutamatergic neurotransmission PMID: 27387482
  • Data describe a missing function of the stress hormone Crh in the regulation of autophagy activation and present evidence that this effect is linked to maintenance of gut homeostasis under basal conditions. PMID: 26987580
  • Real-time PCR analyses revealed that social defeat significantly increased corticotropin-releasing hormone in the paraventricular nucleus. PMID: 25219790
  • Data suggest a physiologically relevant role for local corticotropin-releasing hormone signaling towards shaping the neuronal circuitry within the mouse olfactory bulb. PMID: 25224546
  • results suggest that long-term, post-natal CRF over-expression increases the rewarding effects of cocaine in individuals with high emotional response to stress. PMID: 25094033
  • Knockdown of CRF synthesis in the ventral tegmental area prevented interpeduncular intermediate activation and anxiety during nicotine withdrawal. PMID: 25898242
  • selective disruption of Grin1 within central amygdala CRF neurons strongly enhances fear memory PMID: 25340785
  • it is shown that CRH and UCN upregulate galectin-1 expression in Ishikawa cell line and macrophages and this effect is mediated through CRHR1. PMID: 25473847
  • CRF overexpression throughout the CNS increased startle magnitude and reduced ability to inhibit startle. CRF overexpression confined to inhibitory neurons decreased startle magnitude but had no effect on inhibitory measures. PMID: 25575243
  • The stress response neuropeptide CRF increases amyloid-beta production by regulating gamma-secretase activity. PMID: 25964433
  • These data suggest critical roles for CRF and CRFR1 in tau-P and aggregation and may have implications for the development of Alzheimer disease cognitive decline. PMID: 25125464
  • Study of sex- and genotype-dependent effects of a short, acute predator odor exposure on CRF mRNA levels in stress-related brain regions and subsequently changes in spatial memory retrieval in male and female GAD67 mice and their wildtype littermates PMID: 24946072
  • Chronic nicotine exposure upregulates corticotropin releasing factor mRNA in dopaminergic neurons of the posterior ventral tegmental area. PMID: 25402857
  • Findings suggest that forebrain-specific overexpression of CRF (CRFOE) limited to development is sufficient to induce enduring alterations in startle plasticity and anxiety, while forebrain CRFOE during adulthood results in a different phenotype profile PMID: 24326400
  • Data (including data from studies in knockout mice) suggest that Crh/Crhr1 signal transduction in noradrenergic neurons in cardiac ventricles during morphine withdrawal contributes to cardiovascular dysfunction, mimicking stress-induced dysfunction. PMID: 24490859
  • Adiponectin regulates ACTH secretion and the hypothalamic-pituitary-adrenal axis in an AMPK-dependent manner in pituitary corticotroph cells. PMID: 24361598
  • Impairment of CBP:CREB interaction reduces CRH expression in the hypothalamus on postnatal day nine, but does not disrupt steady-state CRH expression in adult mice PMID: 23768074
  • These observations highlight basic cell-type characteristics of CRH neurons in a mutant mouse. PMID: 23724107
  • corticotropin-releasing hormone knockouts are more susceptible to glucocorticoid receptor changes in early phases of stress. PMID: 23430272
  • CRH was released during water avoidance stress (WAS) and inhibited NLRP6 expression. WAS induced alterations in the gut microbiota of mice; co-housed nonstressed mice developed enteritis associated with increased CRH and decreased levels of NLRP6. PMID: 23470617
  • MicroRNA 375 mediates the signaling pathway of corticotropin-releasing factor (CRF) regulating pro-opiomelanocortin (POMC) expression by targeting mitogen-activated protein kinase 8. PMID: 23430746
  • Corticotropin releasing factor expression was induced in the hippocampus of the mouse pilocarpine model of status epilepticus. PMID: 22326386
  • Overexpression of CRF in Barrington's nucleus CRF in Barrington's nucleus inhibits bladder function and promotes active coping behavior. PMID: 22882375
  • suggesting that perturbations of the CRF system are not the primary cause of decreased cognitive performance PMID: 22336193
  • the NMDA receptor is positioned for the postsynaptic regulation of CRF expressing central nucleus of the amygdala neurons PMID: 23063907
  • CRH and CRHR1 are dynamic modulators of a variety of signal transduction mechanisms and cellular processes. PMID: 22659651
  • corticotropin-releasing factor (CRF), a neuropeptide released in response to acute stressors and other arousing environmental stimuli, acts in the nucleus accumbens of naive mice to increase dopamine release through coactivation of the receptors CRFR1 and CRFR2 PMID: 22992525
  • Central CRH hyperdrive on its own or in combination with elevated glucocorticoids is responsible for the increase in anxiety-related behaviour. PMID: 22198557
  • CRH plays an important role in stress induced hyperphosphorylation of tau protein. PMID: 22222439
  • CRF suppressed GnRH protein levels, Ucn2 can modulate GnRH mRNA levels PMID: 22138165
  • Ghrelin activates hypophysiotropic CRF neurons, albeit indirectly. PMID: 22363652
  • Short-term central amygdala-corticotropin-releasing factor-overexpression enhanced the stress-induced anxiety-like behaviors in transgenic mice PMID: 21783178
  • CRF(1) agonists, Ucn 1 and stressin(1) -A, reduced feeding and induced interoceptive stress, whereas Ucn 2 potently suppressed feeding via a CRF(2) -dependent mechanism without eliciting malaise [stressin 1-A] PMID: 21627635
  • CRF signaling in the central nucleus of the amygdala is engaged during binge-like ethanol consumption by C57BL/6J mice. PMID: 22399763
  • In mice with MECP2 duplication, reducing the levels of Crh or its receptor, Crhr1, suppressed anxiety-like behavior; in contrast, reducing Oprm1 expression improved abnormal social behavior. PMID: 22231481
  • Leucine deprivation stimulates fat loss by increasing expression of corticotrophin-releasing hormone in the hypothalamus via activation of stimulatory G protein/cAMP/protein kinase A/cAMP response element-binding protein pathway. PMID: 21719534
  • The immunomodulatory effects of CRH may include an important, albeit not explored yet, role in epidermal tissue remodeling and regeneration and maintenance of tissue homeostasis. PMID: 21765902
  • These results show possible differential roles for CRF expressed by distinct loci of the extended amygdala, in mediating stress-induced emotional behaviors. PMID: 20548294

    • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    More from All Products
    Tn5 Transposase
    • Expression system: E.coli;
    CAT#: TN5-BL01
    Sale
    SDS-PAGE analysis of Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein, CAT# BLT-08873P showing >85% purity under 15% SDS-PAGE (Reduced)
    Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein
    • Molecule: SHFL;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+sumo;
    • Sequence: 1-291;
    CAT#: BLT-08873P

    Save $50
    Sale
    SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein
    • Molecule: NDUFV1;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+SUMO;
    • Sequence: 21-464aa;
    CAT#: BLT-08321P

    Save $50
    Sale
    SDS-PAGE analysis of Human NEU2 (Sialidase-2) - Recombinant Protein, CAT# BLT-08142P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NEU2 (Sialidase-2) - Recombinant Protein
    • Molecule: NEU2;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 1-380aa;
    CAT#: BLT-08142P

    Save $50
    Sale
    SDS-PAGE analysis of Mouse Cebpb (Ccaat/Enhancer-Binding Protein Beta) - Recombinant Protein, CAT# BLT-08014P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Mouse Cebpb (Ccaat/Enhancer-Binding Protein Beta) - Recombinant Protein
    • Molecule: CEBPB;
    • Species: Mouse;
    • Expression system: E.coli;
    • Tag: N-His-GST;
    • Sequence: 1-296aa;
    CAT#: BLT-08014P

    Save $50
    Sale
    SDS-PAGE analysis of Human BAX (Apoptosis Regulator Bax) - Recombinant Protein, CAT# BLT-07419P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human BAX (Apoptosis Regulator Bax) - Recombinant Protein
    • Molecule: BAX;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 1-171aa;
    CAT#: BLT-07419P

    Save $50
    Recently viewed