Recombinant Mouse Complement C1Q-Like Protein 3 (C1QL3) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-04991P
Greater than 85% as determined by SDS-PAGE.
Recombinant Mouse Complement C1Q-Like Protein 3 (C1QL3) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-04991P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mouse Complement C1Q-Like Protein 3 (C1QL3) Protein (His&Myc) is produced by our Baculovirus expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q9ESN4 |
| Target Symbol | C1QL3 |
| Synonyms | C1ql3; C1ql; Ctrp13Complement C1q-like protein 3; C1q and tumor necrosis factor-related protein 13; C1q/TNF-related protein 13; CTRP13; Gliacolin |
| Species | Mus musculus (Mouse) |
| Expression System | Baculovirus |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | HYEMLGTCRMVCDPYGGTKAPSTAATPDRGLMQSLPTFIQGPKGEAGRPGKAGPRGPPGEPGPPGPVGPPGEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNYDYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYAD |
| Expression Range | 21-255aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 28.6 |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses. Plays a role in glucose homeostasis. Via AMPK signaling pathway, stimulates glucose uptake in adipocytes, myotubes and hepatocytes and enhances insulin-stimulated glucose uptake. In a hepatoma cell line, reduces the expression of gluconeogenic enzymes G6PC1 and PCK1 and hence decreases de novo glucose production. |
| Subcellular Location | Secreted. |
| Database References | KEGG: mmu:227580 STRING: 10090.ENSMUSP00000056188 UniGene: PMID: 28553739 |
