Recombinant Mouse Collagen alpha-1 (COL4A1) Protein (His)

Name: Recombinant Mouse Collagen alpha-1 (COL4A1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-06281P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Collagen alpha-1 (COL4A1) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Activity	Not tested.
Uniprotkb	P02463
Target Symbol	COL4A1
Synonyms	(IV)
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	C-6His
Target Protein Sequence	GFLVTRHSQTTDDPLCPPGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPISGDNIRPFISRCAVCEAPAMVMAVHSQTIQIPQCPNGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT
Expression Range	1445-1669aa
Protein Length	Partial
Mol. Weight	31.8 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen.; Arresten, comprising the C-terminal NC1 domain, inhibits angiogenesis and tumor formation. The C-terminal half is found to possess the anti-angiogenic activity. Specifically inhibits endothelial cell proliferation, migration and tube formation.
Subcellular Location	Secreted, extracellular space, extracellular matrix, basement membrane.
Protein Families	Type IV collagen family
Database References	KEGG: mmu:12826 STRING: 10090.ENSMUSP00000033898 UniGene: PMID: 28057519 Embryo implantation triggers dynamic spatiotemporal expression of the basement membrane toolkit (Col4a1, GPBP, Lamc1, peroxidasin) during uterine reprogramming. PMID: 27619726 the lens and possibly vasculature play important roles in Col4a1-related anterior segment dysgenesis. PMID: 28237965 Mutations in murine Col4a1 and Col4a2 genes affected the balance between lung epithelial progenitors and differentiated cells. Mutations in Col4a1 derived from the vascular component were sufficient to cause defects in vascular development and the blood-gas barrier. Col4a1 and Col4a2 mutants displayed disrupted myofibroblast proliferation, differentiation and migration. PMID: 27412481 This extensive description of the muscular phenotype of the Col4a1 HANAC murine model suggests a potential contribution of primary endothelial cell defects, together with muscle BM alterations, to the development of COL4A1-related myopathy. PMID: 28056338 data show that both basement membrane defects and ER stress contribute to Col4a1 renal disease, which has important implications for the development of treatment strategies for collagenopathies PMID: 26839400 Silencing the Col4-alpha1 gene or disrupting integrin engagement by blocking the antibody reduced the expression of platelet-derived growth factor A (PDGF-A), a potent chemotactic factor for fibroblasts. PMID: 25686533 Col4a1 mutations cause abnormal vascular development, which triggers small-vessel disease, recurrent hemorrhagic strokes, and age-related macroangiopathy. PMID: 25753534 Down-regulation let-7 by transforming growth factor-beta1-induced Lin28 upregulates collagen expression in glomerular mesangial cells from diabetic mice. PMID: 25354942 COL4A1 and COL4A2 mutations are pleiotropic and cause a wide spectrum of disorders, including ocular dysgenesis, brain malformations and myopathy, of variable severity in both mice and humans. PMID: 24203695 WT1 maintains testicular cord integrity by additively regulating the expression of basal lamina components Col4a1 and Col4a2 with SOX9. PMID: 23325811 show that heterozygous Col4a1 mutant mice have ocular dysgenesis, neuronal localization defects, and myopathy characteristic of Muscle-eye-brain disease/Walker-Warburg syndrome PMID: 21625620 Data suggest that podocyte von Hippel-Lindau protein is required for normal maintenance of podocytes, basment membrane collagen {alpha}1{alpha}2{alpha}1(IV) deposition and ultrastructure, neuroglobin experssion and glomerular barrier properties. PMID: 20522651 Collectively, our results suggest that vascular basement membrane components substantially impact gene expression in astrocytes during brain tissue repair. PMID: 20091789 Mutations in COL4A1 result in a complex vascular phenotype encompassing defects in maintenance of vascular tone, endothelial cell function and blood pressure regulation. PMID: 20056676 Collagen type IV and Perlecan exhibit dynamic localization in the Allantoic Core Domain. PMID: 19924818 In murine embryos, collagen IV subunits alpha1(IV), alpha2(IV), alpha5(IV) and alpha6(IV) were detected in the basement membrane surrounding the lens vesicle, and they persisted in the capsule until adulthood. PMID: 12225806 findings show that mutations in Col4a1 can lead to perinatal cerebral hemorrhage and can predispose to porencephaly; propose that Col4a1 mutations conspire with environmental trauma in causing the disease PMID: 15905400 Dominant mutations of Col4a1 result in basement membrane defects which lead to anterior segment dysgenesis and glomerulopathy. PMID: 16159887 In this report, we show that a mutation in the mouse Col4a1 gene, encoding procollagen type IV alpha1, predisposes both newborn and adult mice to intracerebral hemorrhage. PMID: 16598045 The genetic, molecular, and phenotypic characterization of nine Col4a1 and three Col4a2 missense mutations recovered in random mutagenesis experiments in the mouse, are presented. PMID: 17179069 Results show that a mutation in Col4a1 gene can cause both ocular anterior segment dysgenesis and optic nerve hypoplasia. PMID: 17317786 Foxc2 plays an important role in the development of the mesenchyme through the regulation of MyoD gene expression but does not regulate Collagen type IV alpha 1 (Col4a1) or Col4a2 PMID: 17506979

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.