Recombinant Mouse Chitinase Domain-Containing Protein 1 (CHID1) Protein (His-Myc)
Beta LifeScience
SKU/CAT #: BLC-05090P
Greater than 85% as determined by SDS-PAGE.
Recombinant Mouse Chitinase Domain-Containing Protein 1 (CHID1) Protein (His-Myc)
Beta LifeScience
SKU/CAT #: BLC-05090P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mouse Chitinase Domain-Containing Protein 1 (CHID1) Protein (His-Myc) is produced by our Mammalian cell expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q922Q9 |
| Target Symbol | CHID1 |
| Synonyms | Chid1Chitinase domain-containing protein 1 |
| Species | Mus musculus (Mouse) |
| Expression System | Mammalian cell |
| Tag | N-6His-Myc |
| Target Protein Sequence | TLSKSDAKKAASKMLLEKTQFSDKPVQDRGLVVTDIKAEDVVLEHRSYCSSRARERNFAGEVLGYVTPWNSHGYDVAKVFGSKFTQISPVWLQLKRRGREMFEITGLHDVDQGWMRAVKKHAKGVRIVPRLLFEDWTYDDFRNVLDSEDEIEELSKTVAQVAKNQHFDGFVVEVWSQLLSQKHVGLIHMLTHLAEALHQARLLVILVIPPAVTPGTDQLGMFTHKEFEQLAPILDGFSLMTYDYSTSQQPGPNAPLSWIRACVQVLDPKSQWRSKILLGLNFYGMDYAASKDAREPVIGARYVQTLKDHRPRVVWDSQAAEHFFEYKKNRGGRHVVFYPTLKSLQVRLELARELGVGVSIWELGQGLDYFYDLL |
| Expression Range | 20-393aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 46.9 |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Saccharide- and LPS-binding protein with possible roles in pathogen sensing and endotoxin neutralization. Ligand-binding specificity relates to the length of the oligosaccharides, with preference for chitotetraose (in vitro). |
| Subcellular Location | Secreted. Lysosome. |
| Protein Families | Glycosyl hydrolase 18 family |
| Database References |
