Recombinant Mouse Cgmp-Specific 3,5-Cyclic Phosphodiesterase (PDE5A) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-05137P
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Pde5a.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Pde5a.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Pde5a.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Pde5a.

Recombinant Mouse Cgmp-Specific 3,5-Cyclic Phosphodiesterase (PDE5A) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-05137P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Mouse Cgmp-Specific 3,5-Cyclic Phosphodiesterase (PDE5A) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb Q8CG03
Target Symbol PDE5A
Synonyms Pde5a; Pde5; cGMP-specific 3',5'-cyclic phosphodiesterase; EC 3.1.4.35; cGMP-binding cGMP-specific phosphodiesterase; CGB-PDE
Species Mus musculus (Mouse)
Expression System E.coli
Tag N-10His&C-Myc
Target Protein Sequence DVTALCHKIFLHIHGLISADRYSLFLVCEDSSKDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAAFGEPLNIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENKRN
Expression Range 154-320aa
Protein Length Partial
Mol. Weight 26.1 kDa
Research Area Cancer
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This phosphodiesterase catalyzes the specific hydrolysis of cGMP to 5'-GMP. Specifically regulates nitric-oxide-generated cGMP.
Protein Families Cyclic nucleotide phosphodiesterase family
Database References

KEGG: mmu:242202

STRING: 10090.ENSMUSP00000069011

UniGene: PMID: 28294194

  • the activation of PDE5 is among the mechanisms contributing to the cGMP decrease, these results suggest that another cGMP phosphodiesterase is also activated by LH signaling. PMID: 29341896
  • Report expression of Pde5a1/2/3 in cardiac myocytes and suggest role in induction of cardiac hypertrophy. PMID: 28247930
  • Upon S-nitrosylation, PDE5 exhibits reduced activity and degradation via the ubiquitin-proteasome system. PMID: 26093192
  • Short-term hemolysis is sufficient to establish a priapism phenotype and results in loss of erectile function. PDE5I treatment ameliorates priapism, in part, because of restored NO balance with decreased ROS generation and increased PDE5 activity. PMID: 26346631
  • Inhibition of type 5 phosphodiesterase counteracts beta2-adrenergic signalling in beating cardiomyocytes. PMID: 25852085
  • Addition of sildenafil, a phosphodiesterase 5 (PDE5) inhibitor, in the drinking water had a small effect in reducing myocyte hypertrophy in wild type mice and no effect in betaRM mice. PMID: 25139994
  • findings reveal that excess adenosine-mediated ADORA2B signaling underlies reduced penile PDE activity by decreasing PDE5 gene expression in a HIF-1alpha-dependent manner PMID: 24614760
  • Phosphodiesterase 5 attenuates the vasodilatory response in renovascular hypertension. PMID: 24260450
  • Findings suggest that continuous, long-term treatment with PDE5 inhibitors reverses eNOS uncoupling in the sickle cell penis which restores endothelial NO synthesis. PMID: 23844149
  • Data indicate that the phosphodiesterase 5 (PDE5) expression is equal in the splenocytes from both genders, but splenocytes from female mice possess higher basal level of cGMP compared to the male ones. PMID: 23911424
  • Myocardial PDE5 expression is increased in the hearts of humans and mice with chronic pressure overload. PMID: 23527037
  • Sildenafil-mediated PDE5 inhibition significantly reduces diaphragm respiratory muscle dysfunction and pathology in the mdx mouse model of Duchenne muscular dystrophy. PMID: 22653783
  • these data strongly support a primary role of myocyte PDE5 regulation to myocardial pathobiology PMID: 20970280
  • PDE5-inhibition blocks TRPC6 channel activation and associated Cn/NFAT activation signaling by PKG-dependent channel phosphorylation PMID: 19961855
  • PDE5 inhibition enhances ischemia-induced angiogenesis with mobilization of endothelial progenitor cells through a protein kinase G-dependent HIF-1/vascular endothelial growth factor pathway. PMID: 20413734
  • phosphorylation and functional suppression of TRPC6 underlie prevention of pathological hypertrophy by PDE5 inhibition. PMID: 20177073
  • Myocardial oxidative stress increases PDE5 expression in the failing heart PMID: 20308615
  • Data show that recombinant cyclic GMP-binding phosphodiesterase 5 (PDE5) is activated directly upon cGMP binding to the GAF A domain, and this effect does not require PDE5 phosphorylation. PMID: 12554648
  • PDE5A has a novel regulatory role in hearts under adrenergic stimulation. PDE5A catabolic regulation is specific coupled with NOS3-derived cGMP attributable to protein subcellular localization and targeted synthetic/catabolic coupling. PMID: 15576651
  • findings show a much greater role of PDE5A in hearts subjected to sustained pressure load and that PDE5A inhibition in this setting prevents and reverses cardiac chamber, cellular and molecular remodeling induced by this stimulus PMID: 15665834
  • sildenafil inhibits PDE5 and preconditions adult cardiac myocytes against necrosis and apoptosis PMID: 15668244
  • Priapism causes dysregulated PDE5A expression/activity suggesting that PDE5A dysregulation is a fundamental mechanism for priapism. PMID: 15668387
  • Regulation of cardiac beta-adrenergic response by cGMP is specifically linked to a nitric oxide-synthesis/PDE-5-hydrolyzed pool signaling via protein kinase G. PMID: 17420342
  • Inhibition by sildenafil ameliorates right ventricular hypertrophy and pulmonary fibrosis caused by intratracheal bleomycin. PMID: 17965319
  • Upregulating the NO/cGMP pathway by PDE-5 inhibition during hypoxia reduces neuron apoptosis, regardless of HIF-1alpha, through an interaction involving ERK1/2 and p38. PMID: 18641057
  • sildenafil activates a PKG-dependent novel signaling cascade that involves activation of ERK and inhibition of glycogen synthase kinase 3beta leading to cytoprotection PMID: 18723505
  • Ten weeks after myocardial infarction, left ventricular end-systolic and end-diastolic volumes were larger in PDE5-transgenic than in wild-type mice. PMID: 19139381
  • These data suggests a novel physiological role for PDE5 in restricting the effects of NOS3/sGC/PKG signaling pathway to modulating beta-AR stimulated I(Ca), while limiting effects on cardiac contraction. PMID: 19345227
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed