Recombinant Mouse Cd109 Antigen (CD109) Protein (His)

Name: Recombinant Mouse Cd109 Antigen (CD109) Protein (His)
Brand: Beta LifeScience
SKU: BLC-06217P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Cd109 Antigen (CD109) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Activity	Not tested.
Uniprotkb	Q8R422
Target Symbol	CD109
Synonyms	GPI-anchored alpha-2 macroglobulin-related protein;CD antigen CD109
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-10His
Target Protein Sequence	DKSVTLMENSNSITMETMVHELELYNTEYYLGMFMNSFAVFQECGLWVLTDATLIRDSIDEVYDTEEYSERFAEENEANLVDFEDASSVNNVHVRKNFPETWIWLDAYMG
Expression Range	595-704aa
Protein Length	Partial
Mol. Weight	18.9 kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Modulates negatively TGFB1 signaling in keratinocytes.
Subcellular Location	Cell membrane; Lipid-anchor, GPI-anchor.
Protein Families	Protease inhibitor I39 (alpha-2-macroglobulin) family
Database References	KEGG: mmu:235505 STRING: 10090.ENSMUSP00000091330 UniGene: PMID: 29767469 CD109 deficiency suppresses skin tumorigenesis by enhancing TGF-beta/Smad/Nrf2 pathway activity and decreasing the mutation frequency of the H-ras gene. PMID: 27756876 High expression of CD109 in brain tumor stem cells is involved in glioma progression. PMID: 28888050 platelet and endothelial GARP are not important in hemostasis and thrombosis in mice PMID: 28278197 Small-scale in vivo screening identified several genes, including Cd109, that encode novel pro-metastatic factors. We uncovered signaling mediated by Janus kinases (Jaks) and the transcription factor Stat3 as a critical, pharmacologically targetable effector of CD109-driven lung cancer metastasis PMID: 28191885 CD109 differentially regulates TGF-beta-induced ALK1-Smad1/5 versus ALK5-Smad2/3 pathways, leading to decreased extracellular matrix production in the skin; epidermal CD109 expression regulates dermal function through a paracrine mechanism PMID: 27866969 the GARP/LTGF-beta1 complex on Treg cells is a major source of TGF-beta1 needed for induction of pTreg cells during the process of oral tolerance. PMID: 27062243 GP96 serves as an essential chaperone for the cell-surface protein glycoprotein A repetitions predominant (GARP), which is a docking receptor for latent membrane-associated TGF-beta (mLTGF-beta). PMID: 25607841 CD109 decreases extracellular matrix production and fibrotic responses during hypoxic wound healing PMID: 24815824 CD109 is present in serum as a soluble form, and suggest its potential as a novel tumor marker in patients with cancers that express CD109. PMID: 24400073 CD109 might be an important regulator of osteoclastogenesis. PMID: 23593435 findings demonstrate that CD109 overexpression in the epidermis reduces inflammation and granulation tissue area and improves collagen organization in vivo. PMID: 23438099 Induction of both Th17-producing cells and Tregs is caused preferentially by Tregs expressing the latent TGF-beta1/GARP complex on their cell surface rather than by secreted latent TGF-beta1. PMID: 23645881 CD109 overexpression ameliorates skin fibrosis in a mouse model of bleomycin-induced scleroderma. PMID: 23436317 CD109 regulates differentiation of keratinocytes via a signaling pathway involving Stat3. PMID: 22846721

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.