Recombinant Mouse Cathepsin S (CTSS) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03076P
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) ctss.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) ctss.
Recombinant Mouse Cathepsin S (CTSS) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03076P
Collections: Enzymes, Featured enzyme molecules, Protease, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Cathepsin S (CTSS) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | O70370 |
Target Symbol | CTSS |
Synonyms | Ctss; CatsCathepsin S; EC 3.4.22.27 |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | LPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI |
Expression Range | 123-340aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 27.7kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Thiol protease. Key protease responsible for the removal of the invariant chain from MHC class II molecules and MHC class II antigen presentation. The bond-specificity of this proteinase is in part similar to the specificities of cathepsin L. |
Subcellular Location | Lysosome. Secreted. Cytoplasmic vesicle, phagosome. |
Protein Families | Peptidase C1 family |
Database References | |
Tissue Specificity | Widely expressed with highest expression found in non-skeletal tissues. Relatively high levels found in skeletal tissues. Expressed in spleen, B cells, dendritic cells and macrophages. |
Gene Functions References
- The present data indicating that Cat-S activity increases with CKD progression suggest that Cat-S might be a therapeutic target to prevent cardiovascular complications in CKD. PMID: 28240259
- CatS(-/-) mice exhibited impaired social interaction and social novelty recognition in the three-chamber test. PMID: 28623134
- Cathepsin S activity controls injury-related vascular remodeling via TLR2/p38MAPK/PI3K/Akt/p-HDAC6 signaling pathway. PMID: 27365406
- Ctss induction during muscular dystrophy is a pathologic event that partially underlies disease pathogenesis, and its inhibition might serve as a new therapeutic strategy in Duchenne muscular dystrophy. PMID: 26966179
- Fluorogen substrate, Mca-GRWPPMGLPWE-Lys(Dnp)-DArg-NH2 can detect CTSS activities in mouse antigen presenting cells. PMID: 26899824
- Data show that cathepsins S (CatS) regulates CCL2 chemokine expression by modulation of CD74 antigen processing. PMID: 26358505
- Cathepsin S activates MrgprC11 and evokes receptor-dependent scratching in mice. PMID: 26216096
- cathepsin S deficiency alters the balance between adipocyte and osteoblast differentiation, increases bone turnover, and changes bone microarchitecture. Therefore, bone and fat metabolisms should be monitored when using cathepsin S inhibitors clinically PMID: 24780878
- results identify Cat-S as a biased agonist of PAR2 that causes PAR2- and TRPV4-dependent inflammation and pain. PMID: 25118282
- Cathepsin S contributes to macrophage migration via degradation of elastic fibre integrity to facilitate neointima formation of vein grafts PMID: 24319016
- CatS also reduced myocardial Smad2 and Smad3 activation and extra domain A fibronectin expression PMID: 23771947
- CatS is involved in the secondary injury after traumatic brain injury PMID: 24282339
- Disruption of CatS therefore induces hyperlocomotor activity due to failure to downscale the synaptic strength. PMID: 24067868
- These results show a peripheral pivotal role of CatS in the development of neuropathic pain through the antigen-specific activation of CD4(+) T-cells PMID: 24553941
- High cathepsin S promotes cancer growth and neovascularization. PMID: 23629809
- Provide direct evidence that Cat S plays an important role in abdominal aortic aneurysm formation in apoE-deficient mice. PMID: 22871592
- GILT expression decreased the proteolysis of a CatS selective substrate. PMID: 23012103
- Cathepsin S deficiency results in abnormal accumulation of autophagosomes in macrophages and enhances Ang II-induced cardiac inflammation. PMID: 22558139
- Overexpression of cathepsin S induces chronic atopic dermatitis in mice. PMID: 22170489
- Cat-S activates nociceptors to induce visceral pain via protease-activated receptor-2. PMID: 21802389
- only prophylactic Cat S inhibitor dosing blocked lung inflammation, consistent with our findings in Cat S knockout mice. PMID: 20855652
- Cathepsin S inhibition prevented the formation of lung granulomas in a mouse model of sarcoidosis. PMID: 21251246
- Cat S derived from macrophages is involved in the mechanisms of atherosclerotic plaque vulnerability in apoE-deficient mice PMID: 20079903
- For a subset of antigens, epitope generation is critically regulated by cathepsin S, which participates in antigen processing and generates qualitative and quantitative differences in the peptide repertoires displayed by MHC class II molecules. PMID: 11884425
- regulation of the phagosomal CatS, CatL, CatB and CatZ contents during dendritic cell activation PMID: 12186844
- cathepsin S contributes to angiogenesis by microvascular endothelial cells. PMID: 12600886
- In vivo, nonprofessional histocompatibility class (MHC) II-expressing antigen presenting cells of the intestinal epithelium use Cat S, but not Cat L, for MHC class II-mediated antigen presentation. PMID: 15661874
- First direct genetic evidence is reported for a key role of cathepsin S in autoimmune responses to acetylcholine receptor and in the pathogenesis of experimental autoimmune myasthenia gravis. PMID: 15661938
- Transgenic interferon-gamma induces alveolar epithelial cell DNA injury and apoptosis via a novel murine cathepsin S-dependent pathway, a critical event in the pathogenesis of alveolar remodeling, emphysema and inflammation. PMID: 15944319
- The increases in mRNA levels for CatS and GPX3 found in the aging C57BL/6 RPE/choroid appear to represent an increase in both the numbers of cells expressing these messages and an increase in the level of expression in individual cells. PMID: 15947738
- Cathepsin S has a unique role in determining the morphology of class II MHC-positive endosomal compartments PMID: 16094690
- interleukin-6-signal transducer and activator of transcription 3 -mediated increase of cathepsin S activity PMID: 16286017
- Data show that cathepsin S deficiency impairs angiogenesis and tumor cell proliferation, impairing angiogenic islet formation and the growth of solid tumors; while the absence of its endogenous inhibitor cystatin C resulted in opposite phenotypes. PMID: 16365041
- plays an important role in atherosclerotic plaque destabilization and rupture PMID: 16410454
- Plays role in migration and activation of microglia to protect facial motoneurons against axotomy-induced injury. PMID: 17539023
- These results indicate that seizures induced by kainate elicit neurodegeneration, astrogliosis, and microglial activation accompanied by the expression of cathepsin S while those induced by nicotine do not. PMID: 17997037
- Upregulation of elastase proteins results in aortic dilatation in mucopolysaccharidosis I mice. PMID: 18479957
- CAT S participates in inflammatory processes accompanying aging and pathologies of the central nervous system PMID: 18694734
- Leukocyte cathepsin S is a potent regulator of both cell and matrix turnover in advanced atherosclerosis. PMID: 19095996
- catS-induced elastolysis accelerates arterial and aortic valve calcification in chronic renal disease PMID: 19307473
- The active form of cathepsin S was identified as being significantly up-regulated in poorly differentiated TRAMP tumours. PMID: 19487544