Recombinant Mouse Cathepsin L1 (CTSL) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-05270P
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctsl.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctsl.
Recombinant Mouse Cathepsin L1 (CTSL) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-05270P
Collections: Enzymes, Featured enzyme molecules, Protease, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Cathepsin L1 (CTSL) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P06797 |
Target Symbol | CTSL |
Synonyms | Ctsl; Ctsl1Cathepsin L1; EC 3.4.22.15; Cathepsin L; Major excreted protein; MEP; p39 cysteine proteinase) [Cleaved into: Cathepsin L1 heavy chain; Cathepsin L1 light chain] |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-6His&C-Myc |
Target Protein Sequence | IPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGT |
Expression Range | 114-288aa |
Protein Length | Partial |
Mol. Weight | 26.2 kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Thiol protease important for the overall degradation of proteins in lysosomes (Probable). Involved in the solubilization of cross-linked TG/thyroglobulin and in the subsequent release of thyroid hormone thyroxine (T4) by limited proteolysis of TG/thyroglobulin in the thyroid follicle lumen. In neuroendocrine chromaffin cells secretory vesicles, catalyzes the prohormone proenkephalin processing to the active enkephalin peptide neurotransmitter. In thymus, regulates CD4(+) T cell positive selection by generating the major histocompatibility complex class II (MHCII) bound peptide ligands presented by cortical thymic epithelial cells. Also mediates invariant chain processing in cortical thymic epithelial cells. Major elastin-degrading enzyme at neutral pH. Accumulates as a mature and active enzyme in the extracellular space of antigen presenting cells (APCs) to regulate degradation of the extracellular matrix in the course of inflammation. Secreted form generates endostatin from COL18A1. Critical for cardiac morphology and function. Plays an important role in hair follicle morphogenesis and cycling, as well as epidermal differentiation. Required for maximal stimulation of steroidogenesis by TIMP1. |
Subcellular Location | Lysosome. Apical cell membrane; Peripheral membrane protein; Extracellular side. Secreted, extracellular space. Secreted. Cytoplasmic vesicle, secretory vesicle, chromaffin granule. |
Protein Families | Peptidase C1 family |
Database References | |
Tissue Specificity | Expressed in thymus, kidney and liver. Expressed in thyroid epithelial cells. Expressed in cortical thymic epithelial cells. Expressed by antigen presenting cells (APCs) such as dendritic cells and macrophages. |
Gene Functions References
- findings suggest that CTSL contributes to the proliferation and metastasis of breast cancer and might be a potent molecular target for breast cancer treatment PMID: 26639231
- causally involved in the pathogenesis of experimental diabetic nephropathy PMID: 27575559
- findings suggest that single chain-cathepsin L is biologically active in promoting Th17 generation and is counter-regulated by serpinB1 and secondarily by asparagine endopeptidase. PMID: 26343333
- CTSL plays an important role in the MHC class II-mediated peptide presentation in thymic epithelial cells, acting both in the invariant chain degradation and in the generation of MHC class II-bound peptide ligands presented by cortical thymic epithelial cells. Consequently, CTSL plays an important role in the positive selection of CD4+ T cell in thymus. PMID: 11119260
- genetic blockade of cathepsin L activity is inferred to retard Myc-driven tumor growth, encouraging the potential utility of pharmacological inhibitors of cysteine cathepsins in treating late stage tumors. PMID: 25927437
- The phenotypes of cathepsin L deficiency can be fully assigned to lack of canonically targeted cathepsin L, while the biogenesis and functionality of nucleo-cytosolic cathepsin L remain elusive. PMID: 25222295
- in vivo functional evidence for overexpressed CTSL as a promoter of lung metastasis, whereas high CTSL levels are maintained during tumor progression due to stress-resistant mRNA translation. PMID: 25957406
- cathepsin L has a protective role in mouse skin carcinogenesis PMID: 21538579
- Cathepsin L is involved in nociception in mice, whereas peripheral autophagy and cathepsin L contribute, at least in part, to the antinociceptive effect of dimethoxybenzylidene in mice. PMID: 23912553
- a degradative Ctsl-MMP-2 axis, resulting in increased MMP-2 levels upon cathepsin deficiency with subsequent degradation of secreted proteins such as collagen alpha-1 (I). PMID: 23811845
- Cathepsin L protects mice from mycoplasmal infection and is essential for airway lymphangiogenesis. PMID: 23600672
- B-cell lymphopoiesis is regulated by cathepsin L. PMID: 23585893
- Lysosomal CTSL attenuates cardiac hypertrophy and preserves cardiac function through facilitation of autophagy and proteasomal protein processing. PMID: 23608608
- Two new thyroiditogenic thyroglobulin (Tg)epitopes are located near cathepsin L cleavage sites, clustered close to known immunopathogenic Tg epitopes. PMID: 23315080
- Bushen tiaojing recipe and xiaoyao pill promoted ovulation by enhancing the expression of CatL. PMID: 21434350
- Cathepsins L and Z are critical in degrading polyglutamine-containing proteins within lysosomes. PMID: 22451661
- Cathepsin L contributes to abdominal aortic aneurysms formation by promoting lesion inflammatory cell accumulation, angiogenesis, and protease expression. PMID: 21868704
- Cathepsin L deficiency affects, albeit in a limited manner, the abundances of extracellular matrix (ECM) components, signaling proteins, and further proteases as well as endogenous protease inhibitors. PMID: 21972973
- Defects in DNA repair associated with 53BP1 deficiency upon loss of A-type lamins are due to upregulation of CTSL. PMID: 21750527
- Cathepsin L deficiency significantly reduced lung granuloma number in a mouse model of sarcoidosis. PMID: 21251246
- CTSL regulates cardiac repair and remodelling post-myocardial infarction through a mechanism with multiple pathways. PMID: 21147810
- Downregulation of cathepsin L prevents autoimmune diabetes via suppression of CD8(+) T cell activity. PMID: 20877570
- Data from studies using embryonic cells from Ctsl knockout mice confirm Ctsl as a major protease involved in turnover of phagosomes/lysosomes. PMID: 20536383
- Granule-bound cathepsins are essential for processing perforin to its active form, and that CatL is an important, but not exclusive, participant in this process. PMID: 20497254
- cathepsin L expressed in endothelial progenitor cells plays a critical role in intraocular angiogenesis PMID: 20304958
- conclude that a tightly regulated balance between cathepsin L and cystatin M/E is essential for tissue integrity in epidermis, hair follicles, and corneal epithelium PMID: 20495178
- NOD knock-out mice exhibit complete resistance to diabetes PMID: 19664906
- These results demonstrate a prominent role for cathepsin L, jointly with PC1/3 and PC2, for production of dynorphins in brain. PMID: 19837164
- Data suggest that Ctsl is critical for the termination of growth factor signaling in the endosomal/lysosomal compartment of keratinocytes and, therefore, functions as an anti-tumor protease. PMID: 20023699
- In mouse models of pancreatitis, absence of cathepsin L induces apoptosis and reduces disease severity. PMID: 19900452
- Results suggest that cathepsin L functions as a major protease responsible for CCK8 production in mouse brain cortex, and participates with PC1/3 for CCK8 production in pituitary cells. PMID: 19589362
- For a subset of antigens, epitope generation is critically regulated by cathepsin L, which participates in antigen processing and generates qualitative and quantitative differences in the peptide repertoires displayed by MHC class II molecules. PMID: 11884425
- An alternate targeting pathway for procathepsin L in mouse fibroblasts PMID: 11929604
- Dilated cardiomyopathy in mice deficient for the lysosomal cysteine peptidase cathepsin L. PMID: 11972068
- cathepsin L is the primary mediator of reovirus disassembly PMID: 11986312
- Cathepsin L regulates CD4+ T cell selection independently of its effect on invariant chain: a role in the generation of positively selecting peptide ligands PMID: 12021314
- mice lacking cathepsin L have neuronal loss and brain atrophy; demonstrates pivotal role in maintenance of the central nervous system PMID: 12048238
- shows evolution in placental expression by gene duplication PMID: 12054558
- cathepsin L plays a critical role in hair follicle morphogenesis and cycling, as well as epidermal differentiation PMID: 12163394
- regulation of the phagosomal CatL, CatB, CatS ans CatZ contents during dendritic cell activation PMID: 12186844
- Studies of thymocytes from knockout mice demonstrate a specific role for catL in regulating presentation of natural CD1d ligands mediating V(alpha)14(+)NK1.1(+) T cell selection. PMID: 12368909
- major histocompatibility complex class II-associated invariant chain controls the activity of extracellular cathepsin L PMID: 12417635
- Data show that impaired cathepsin-L function may lead to the establishment of gingival overgrowth as seen in patients treated with calcium antagonists. PMID: 12466121
- Prevents atrophy of seminiferous tubules and promotes the formation of preleptotene spermatocytes and the differentiation of these meiotic cells into pachytene spermatocytes. PMID: 12533435
- cathepsin L plays a regulatory role early in the process of mammary gland involution PMID: 12815617
- Cathepsin L has an previously uncharacterized biological role in the production of [Met]enkephalin, an endogenous peptide neurotransmitter PMID: 12869695
- muscle cathepsin L gene expression is increased in diabetes-prone mice and related to glucose tolerance. PMID: 12941783
- A cathepsin L isoform devoid of a signal peptide loalizes to the nucleus in S phase and processes the CDP/Cux transcription factor. PMID: 15099520
- cathepsin L and alpha(3) integrin have roles in podocyte migration PMID: 15197181
- Data suggest that cathepsin L has a critical role in the integration of circulating endothelial progenitor cells (EPC) into ischemic tissue and is required for EPC-mediated neovascularization. PMID: 15665831