Recombinant Mouse Caspase-12 (CASP12) Protein (His-B2M)
Beta LifeScience
SKU/CAT #: BLC-07586P

Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse Caspase-12 (CASP12) Protein (His-B2M)
Beta LifeScience
SKU/CAT #: BLC-07586P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Caspase-12 (CASP12) Protein (His-B2M) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | O08736 |
Target Symbol | CASP12 |
Synonyms | (CASP-12) |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-6His-B2M |
Target Protein Sequence | MAARRTHERDPIYKIKGLAKDMLDGVFDDLVEKNVLNGDELLKIGESASFILNKAENLVENFLEKTDMAGKIFAGHIANSQEQLSLQFSNDE |
Expression Range | 1-92aa |
Protein Length | Partial |
Mol. Weight | 24.3 kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Involved in the activation cascade of caspases responsible for apoptosis execution. |
Protein Families | Peptidase C14A family |
Database References | |
Tissue Specificity | Mainly expressed in skeletal muscle and lung. |
Gene Functions References
- mice ablated for caspase-12 develop spontaneous obesity and insulin resistance. PMID: 26582949
- Caspase-12 plays a pivotal role in CCl4-induced hepatic apoptosis through the activation of the downstream effector caspase-3 directly and/or indirectly via caspase-9 activation. PMID: 25561786
- We validated caspase-12 as a therapeutic target, ablation of which significantly protects T17M photoreceptors from deterioration. PMID: 26207309
- Findings an increase in multiple unfolded protein response pathways in muscles of the dystrophin-deficient mdx mouse, the model for Duchenne muscular dystrophy. PMID: 24879640
- Tauroursodeoxycholic acid intervention down-regulated GRP78 and CHOP expression and Caspase 12 activation. PMID: 22212133
- Findings indicate that although caspase-12 deficiency results in enhanced pro-inflammatory and immunoregulatory cytokine levels in sera during P. yoelii 17XL infection, these responses are not essential for protection against lethal malaria infection. PMID: 21086719
- caspase-12 competed with NEMO for association with IkappaB kinase-alpha/beta, effectively preventing the formation of the IkappaB kinase complex and inhibiting downstream transcriptional activation by NF-kappaB. PMID: 20876354
- Caspase-12 was required for an effective antiviral immune response, especially for the production of type I interferons through the regulation of TRIM25-mediated ubiquitination of RIG-I. . PMID: 20818395
- Matrix metalloproteinase-3 is increased and participates in neuronal apoptotic signaling downstream of caspase-12 during endoplasmic reticulum stress PMID: 20368330
- Reactive oxygen species promote caspase-12 expression and tubular apoptosis in diabetic nephropathy. PMID: 20299359
- enhanced repair response of Casp12(-/-) mice rendered them more susceptible to colorectal cancer induced by azoxymethane (AOM)+ dextran sulfate sodium. PMID: 20226691
- role of caspase-12-dependent pathway in apoptosis induction by manganese(II) PMID: 11964391
- caspase-12 was activated by poly(Q)(72) aggregates via a pathway independent of caspase-8 and caspase-3 activation, and caspase-12 activation was closely associated with poly(Q) aggregate-mediated cell death PMID: 12045204
- procaspase-9 is a substrate of caspase-12 and ER stress triggers a specific cascade involving caspase-12, -9, and -3 in a cytochrome c-independent manner. PMID: 12097332
- Caspase-12 seems to be involved in neuronal death induced by ischemia/reperfusion. PMID: 12699784
- Pathways involving this enzyme are involved in a neurodegenerative disease in vivo, and thus offer novel potential targets for the treatment of prion disorders. PMID: 14532116
- caspase-12 expression in caspase-12 is regulated by NF-E2 and participates in the development of fully functional signaling pathways linking some G-protein-coupled receptors to alphaIIbbeta3 activation. PMID: 15059849
- both caspases and calpains are involved in 661W photoreceptor apoptosis PMID: 15210718
- The results indicate that oxidative and ER induced stress causing caspase-12 activation are involved in neuronal death and disease progression in ALS. PMID: 15313203
- cloning of promoter PMID: 15701691
- caspase-12 and caspase-4 are not required for the induction of ER stress-induced apoptosis and that caspase-4-like activity is not always associated with an initiating event. PMID: 15975932
- Ribozyme 138 prepared in vitro can site specific cleave mouse caspase-12 mRNA with an excellent efficiency. PMID: 15996037
- Data show that overexpression of X-linked Inhibitor of Apoptosis Protein (XIAP)inhibits caspase-12 cleavage and reduces calpain activity in amyotrophic lateral sclerosis mice. PMID: 16566922
- provides compelling genetic evidence for calpain's role in caspase-12 activation at the endoplasmic reticulum (ER), and reveals a novel role for the ubiquitous calpains in ER-stress induced apoptosis and JNK activation PMID: 16597616
- In mice, caspase-12 deficiency confers resistance to sepsis and its presence exerts a dominant-negative suppressive effect on caspase-1, resulting in enhanced vulnerability to bacterial infection and septic mortality PMID: 16625199
- apoptosis-inducing factor plays the major role in this apoptotic event, whereas caspase-12 has a reinforcing effect PMID: 17088543
- Data show that caspase-12 can compensate for lack of caspase-2 and caspase-3 in female germ cells. PMID: 17245644
- In hippocampal neuroblasts, Ca(++) mobilization from ER and caspase-12 activation are components of the molecular pathway that leads to apoptosis triggered by serum deprivation and may constitute an amplifying loop of the mitochondrial pathway. PMID: 17399692
- Nod activation and resulting antimicrobial peptide production constitute an early innate defense mechanism, and caspase-12 inhibits this mucosal antimicrobial response. PMID: 18329614
- caspase-12 is not necessary for mediating the neurotoxic effects of prion protein misfolding. PMID: 19164919