Recombinant Mouse Carbonic Anhydrase 14 (CA14) Protein (His), Active

Name: Recombinant Mouse Carbonic Anhydrase 14 (CA14) Protein (His), Active
Brand: Beta LifeScience
SKU: BLC-05593P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Carbonic Anhydrase 14 (CA14) Protein (His), Active is produced by our Mammalian cell expression system. This is a protein fragment.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The esterase activity is determined to be greater than 400 pmol/min/-g.
Uniprotkb	Q9WVT6
Target Symbol	CA14
Synonyms	Ca14; Car14; CatmCarbonic anhydrase 14; EC 4.2.1.1; Carbonate dehydratase XIV; Carbonic anhydrase XIV; CA-XIV
Species	Mus musculus (Mouse)
Expression System	Mammalian cell
Tag	C-6His
Complete Sequence	ADGGHHWTYEGPHGQDHWPTSYPECGGDAQSPINIQTDSVIFDPDLPAVQPHGYDQLGTEPLDLHNNGHTVQLSLPPTLHLGGLPRKYTAAQLHLHWGQRGSLEGSEHQINSEATAAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSRLHEIRYKDQKTSVPPFSVRELFPQQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQLEKLQETLSSTEEDPSEPLVQNYRVPQPLNQRTIFASFIQAGPLYTTGEM
Expression Range	16-290aa
Protein Length	Partial
Mol. Weight	31.8 kDa
Research Area	Neuroscience
Form	Liquid
Buffer	0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Reversible hydration of carbon dioxide.
Subcellular Location	Membrane; Single-pass type I membrane protein.
Protein Families	Alpha-carbonic anhydrase family
Database References	KEGG: mmu:23831 UniGene: PMID: 23233153 CAXIV functionally interacts with AE3, forming an extracellular membrane protein complex involved in the regulation of bicarbonate metabolism and pHi in the heart. PMID: 22227327 The presence of CA XIV in the hepatocyte plasma membrane places it at a strategic site to control pH regulation and ion transport between the hepatocytes, sinusoids and bile canaliculi. PMID: 12033992 carbonic anhydrase XIV has a role in selective inhibition of membrane-associated isozymes PMID: 14660577 studies on hippocampal slices on these KO mice showed that either CA can mediate buffering after synaptic transmission in hippocampal slices in the absence of the other, but that eliminating both is as effective in blocking the buffering seen in WT mice PMID: 16260723 CA XIV is expressed in sarcoplasmic reticulum and sarcolemma of skeletal muscle. PMID: 17459948 CA XIV, which regulates extracellular pH and pCO(2), plays an important part in producing a normal retinal light response. PMID: 17485676 CA XIV (along with carbonic anhydrase 4) plays an important role in the regulation of intracellular pH in hippocampus, via facilitation of anion exchanger AE3-mediated chloride-bicarbonate antiporter HCO3 exchange. PMID: 19279262

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.