Recombinant Mouse C-X-C Motif Chemokine 2 Protein (CXCL2) Protein (His)

Name: Recombinant Mouse C-X-C Motif Chemokine 2 Protein (CXCL2) Protein (His)
Brand: Beta LifeScience
SKU: BLC-08346P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, Buy cytokines, chemokines, and growth factors for research online, Chemokines and receptors – essential regulators of immune response, High-quality cytokines for advanced research, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse C-X-C Motif Chemokine 2 Protein (CXCL2) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P10889
Target Symbol	CXCL2
Synonyms	Cxcl2; Mip-2; Mip2; Scyb2C-X-C motif chemokine 2; Macrophage inflammatory protein 2; MIP2
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
Expression Range	28-100aa
Protein Length	Full Length of Mature Protein
Mol. Weight	11.8kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Chemotactic for human polymorphonuclear leukocytes but does not induce chemokinesis or an oxidative burst.
Subcellular Location	Secreted.
Protein Families	Intercrine alpha (chemokine CxC) family
Database References	KEGG: mmu:20310 STRING: 10090.ENSMUSP00000074885 UniGene: PMID: 28928065 TIARP independently down-regulated CXCL2 and IL-6 production by fibroblast-like synoviocytes, and the expression of chemokine receptors (CXCR1 and CXCR2) in neutrophils, with resultant reduction of neutrophil migration into arthritic joints. PMID: 27995997 a paracrine role for Hippo-mediated secretion of CXCL1 and CXCL2 in the production of anti-microbial peptides (beta-defensins), iNOS, NOX2 and pro-inflammatory molecules during mycobacterial infection of the host, is reported. PMID: 27883091 Taken together, the data of the present study demonstrated that TcpC can induce MIP2 production, which may contribute to the characteristic histological change associated with pyelonephritis. PMID: 28765918 mip-2 siRNA and the MIP-2 antibody can reduce the inflammatory effects induced by lipopolysaccharide in macrophage cells. PMID: 28662496 this study demonstrates that in vivo blocking of CXCL1 and CXCL2 can significantly reduce the Mycobacterium tuberculosis-induced bioactive IL-1beta production PMID: 28739876 These data identify suppression of CXCL2 and CXCL5 chemoattractant expression by 11beta-HSD1 as a novel mechanism with potential for regulation of neutrophil recruitment to the injured myocardium, and cardiac fibroblasts as a key site for intracellular glucocorticoid regeneration during acute inflammation following myocardial injury. PMID: 28522730 findings show that SRC-3 contributes to host defense against enteric bacteria, at least in part via upregulating CXCL2 expression to recruit neutrophils PMID: 28053238 p53-mediated induction of PAI-1 expression due to chronic CS exposure exacerbates lung inflammation through elaboration of CXCL1, CXCL2, and CXCR2. PMID: 26747783 Social defeat induced an exposure-dependent increase in mRNA levels of E-selectin, CXCL1, and CXCL2 that increased with additional days of social defeat. PMID: 25445193 MIP-2 directly impairs neonatal pulmonary endothelial cell migration in vitro. PMID: 26163511 SIRT2 regulates LPS induced proximal renal tubules CXCL2 protein expression. PMID: 25349202 miR26a/-26b-COX-2-MIP-2 loop regulates allergic inflammation and the feedback relationship between allergic inflammation and the enhanced tumorigenic and metastatic potential PMID: 25907560 huH1N1 virus PA and NA mediated increased MIP-2 expression early postinfection, resulting in substantial pulmonary neutrophilia with enhanced lung pathology and disease PMID: 25762737 Syndecan-1 is expressed in the parietal peritoneum microvasculature but does not regulate leukocyte recruitment and is not necessary for the presentation of the chemokine MIP-2 in this tissue. PMID: 25184228 Identified TLR2 and S100A8/S100A9 as key regulators of hepatic CXCL-2 expression and neutrophil recruitment. PMID: 24333183 Suggest anti-inflammatory action of daidzein in lung epithelial cells is mediated via a direct interaction with PARP-1, which inhibits RelA/p65 protein PARylation required for the transcriptional modulation of pro-inflammatory chemokines such as Cxcl2. PMID: 24632845 suppression of CXCL2 expression may contribute to the beneficial effect of Am80 as a therapeutic agent for intracerebral hemorrhage. PMID: 24659080 Neutrophil recruitment and the neutrophil cytokines, CXCL1/CXCL2, were suppressed in apo(a)transgenic mice in the abdominal aortic aneurysm model. PMID: 24650562 These data identify a cytokine circuit that involves IL-1beta-induced production of CXCL1 and CXCL2 and leads the recruitment of neutrophils to streptococcal infection sites. PMID: 25114117 Data indicate that levels of toll-like receptors TLR4/4-stimulated chemokines CXCL1 and CXCL2 were selectively enhanced in stressed macrophages via receptor-interacting protein kinase 1 (RIPK1). PMID: 24920846 Commensal bacteria-dependent select expression of CXCL2 contributes to periodontal tissue homeostasis. PMID: 23433011 these results strongly suggest that both lack of HOCl and accumulation of H2O2 due to MPO deficiency contribute to the up-regulation of MIP-2 production in mouse neutrophils stimulated with zymosan PMID: 23438680 Interferonalpha stimulates production of maladaptive proinflammatory CXCL2 by renal tubular cells. PMID: 23657854 the model that mast cells, optimally positioned in close proximity to the vasculature, initiate an early phase of neutrophil recruitment by releasing the chemoattractants CXCL1/CXCL2. PMID: 23645836 The results of this study suggested that MIP-2gamma mediates the pathogenesis of central nervous system disorders associated with neutrophil infiltration in the brain and decreased GLT-1 activity. PMID: 23234294 Systemic treatment with CXCL12 promotes a more stable atherosclerotic lesion phenotype and enhances the accumulation of smooth muscle progenitor cells in these lesions without promoting atherosclerosis. PMID: 23393393 these results suggest that increased production of reactive oxygen species by ATP-stimulated macrophages activates the signalling pathways that promote MIP-2 production which, in turn, induces neutrophil migration PMID: 22564028 TNF-alfa and CXCL-2 mRNAs is induced in mice infected with Leptospira. PMID: 22342618 results show that augmentation of the MIP-2/CXCR2 axis by hyperacetylation of histone H3 on the promoter region of MIP-2 and CXCR2 located in the injured peripheral nerve elicits chronic neuroinflammation through neutrophil accumulation PMID: 22135382 Lipopolysaccharide stimulates the induction of CXCL2 in bone marrow macrophages (BMMs), osteoclast precursors, at the transcription level. PMID: 21507677 MIP-2/CXCL2 induced by Chlamydia pneumoniae infection may initiate lymphocytic lung infiltration that can have long-term effects on tissue (ectopic lymphoid tissue formation) after clearance of active infection. PMID: 20840653 Rho-kinase signalling regulates TNF-alpha and CXC chemokine formation as well as lipid peroxidation in the reperfused colon. PMID: 20593289 The aim of this study was to determine whether acinar cells are a source of KC and MIP-2 and to understand their transcriptional regulation. PMID: 20671197 ATP increases chemokine CXCL2 production via both NFAT transcription factor and protein kinase C/MAP kinase signaling pathways by purinergic receptor P2X7 stimulation in microglia. PMID: 20477948 Receptor activator of NF-kappa B ligand-induced CXCL2 in osteoclast (OC) precursors plays a key role in the attachment, migration, differentiation, and function of OCs. PMID: 20357249 Data show that rotavirus-infected macrophages promote neutrophil chemotaxis in response to rhesus rotavirus type A. PMID: 20234283 The distribution of the functional IL-8 homologues CXCL1/KC, CXCL2/MIP-2, and CXCL5-6/LIX in resting and inflamed murine vessels, is examined. PMID: 20007247 Neutralization of inflammatory chemokine MIP-2 (CXCL2/GRO-beta) attenuates the inflammation, weight loss, and clinical presentation of heterologously infected mice without impacting bacterial burden. PMID: 20065113 These data give strong evidence that TRPC6 operates downstream to CXC-type Gq-protein-coupled chemokine receptors upon stimulation with MIP-2 and is crucial for the arrangement of filamentous actin in migrating neutrophils. PMID: 18983454 Migration of PMNs to the CNS coincided with increased expression of transcripts specific for the CXCR2 ELR-positive chemokine ligands CXCL1, CXCL2, and CXCL5 within the brain PMID: 19893623 Neutrophil-directed MIP-2 expression and protein secretion are low at the incisional site during the first 6 hrs after experimental surgical injury and are at a high level 24 hrs following injury. PMID: 11907123 in study of relevance of chemokine expression to selective migration of t-cells and the disease localization in murine graft-versus-host disease, Mip2 was found to be predominantly expressed in spleen, liver, and skin, and not heart. PMID: 12098066 Macrophage inflammatory protein-2 regulates corneal neovascularization induced by infection with Pseudomonas aeruginosa PMID: 12121220 NO generated after administration of E. coli serves as an important proinflammatory signal to up-regulate MIP-2 expression in vivo. PMID: 12165537 Plasma levelof thisprotein was decreased significantly by clodronic acid-encapsulating liposomes in sepsis induced by P.aeruginosa. PMID: 12604029 High tidal volume ventilation in absence of underlying injury induces intrapulmonary TNF-alpha and MIP-2 expression in mice. PMID: 12807894 These data show that macrophage inflammatory protein (MIP-2) is important for hepatocyte proliferation after partial hepatectomy and that pharmacological MIP-2 doses after hepatic injury accelerate hepatic regeneration. PMID: 12875976 induction of secretion in fibrosarcoma cells by NFkappaB and activation of lymphotoxin beta receptor PMID: 12957791 CXC chemokines play a fundamental role in colonic ischemia/reperfusion and that functional interference with CXC chemokines may protect against pathological inflammation in the colon PMID: 14583342

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.