Recombinant Mouse C-X-C Motif Chemokine 16 (CXCL16) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08340P
Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse C-X-C Motif Chemokine 16 (CXCL16) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08340P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mouse C-X-C Motif Chemokine 16 (CXCL16) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q8BSU2 |
| Target Symbol | CXCL16 |
| Synonyms | Cxcl16; SrpsoxC-X-C motif chemokine 16; Scavenger receptor for phosphatidylserine and oxidized low density lipoprotein; SR-PSOX; Small-inducible cytokine B16; Transmembrane chemokine CXCL16 |
| Species | Mus musculus (Mouse) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLPQASTQTPEAAEGTPSDTSTPAHSQSTQHSTLPSGALSLNKEHTQPWEMTTLPSGYGLEARPEAEANEKQQDDRQQEAPGAGAST |
| Expression Range | 27-198aa |
| Protein Length | Partial |
| Mol. Weight | 22.7kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Induces a strong chemotactic response. Induces calcium mobilization. Binds to CXCR6/Bonzo. Also acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis. |
| Subcellular Location | Membrane; Single-pass type I membrane protein. |
| Protein Families | Intercrine alpha (chemokine CxC) family |
| Database References | KEGG: mmu:66102 STRING: 10090.ENSMUSP00000019064 UniGene: PMID: 30015963 |
