Recombinant Mouse C-X-C Motif Chemokine 15 (CXCL15) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-06984P
Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse C-X-C Motif Chemokine 15 (CXCL15) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-06984P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse C-X-C Motif Chemokine 15 (CXCL15) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q9WVL7 |
Target Symbol | CXCL15 |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | QELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITNRFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLRDSSEVSLTGSDA |
Expression Range | 26-167aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 23.8 kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Chemotactic for neutrophils. Involved in lung-specific neutrophil trafficking during normal and inflammatory conditions. |
Subcellular Location | Secreted. |
Protein Families | Intercrine alpha (chemokine CxC) family |
Database References | |
Tissue Specificity | Expression restricted to the lung, produced by bronchoepithelial cells and is released into the airways. Expressed at low levels in fetal lung. |
Gene Functions References
- inflammation triggered property of Microcystin-LR via IL-8/CXCR2 signaling PMID: 29197248
- this study shows that ponciretin may attenuate ethanol-induced gastritis via the regulation of IL-8 secretion PMID: 28013186
- Adh binds to OR5M11, which enhances Actinobacillus pleuropneumoniae pathogenicity by activating p38 which induces apoptosis of PAMs and IL-8 release PMID: 27046446
- Findings suggest that IL8-dependent osteoclast activation may constitute an early event in the initiation of the joint specific inflammation in anti-citrullinated protein-positive rheumatoid arthritis. PMID: 26612338
- Data suggest that CXCL1/IL-8, released from osteoclasts in an autoantibody-dependent manner, produces pain by activating sensory neurons. PMID: 26613766
- IL-8 signaling is up-regulated in alcoholic hepatitis. PMID: 26260904
- expressions of IL-1beta and IL-8 in the brain increased after ApoE knockout in mice PMID: 25940280
- CYLD negatively regulates nontypeable Haemophilus influenzae-induced IL-8 expression via MKP-1-dependent inhibition of ERK. PMID: 25389768
- Taken together, these results indicate that CD147 promotes lung cancer-induced osteoclastogenesis by modulating IL-8 secretion, and suggest that CD147 is a potential therapeutic target for cancer-associated bone resorption in lung cancer patients. PMID: 25661002
- these data outline a novel role for the P2Y6 receptor in the induction of CXCL8/IL-8 production and barrier dysfunction in response to C. difficile toxin exposure and may provide a new therapeutic target for the treatment of CDI. PMID: 24278446
- these data suggest that IL-8 plays an important role in breast cancer osteolysis PMID: 24486955
- T. crispa ethanol extract fraction was used to investigate the potential immunomodulatory effect of different T. crispa doses ranging from 25 mug/mL to 1000 mug/mL on RAW 246.7 cells by detecting intracellular INF-gamma, IL-6, and IL-8 expressions. PMID: 24969238
- We found that IL-33 could induce and enhance the expression of IL-6 and IL-8 in PBMCs of COPD mice via p38 MAPK pathway. PMID: 24866242
- The hepatic expression of IL8 and LAMC2 has high sensitivity for biliary atresia at diagnosis and may serve as a biomarker of disease, with an important role for the IL8 signaling in experimental disease. PMID: 24493287
- These results suggest that increased IL-8 (mKC) levels may be involved in steroid-resistant neutrophilic airway inflammation through an NF-kappaB-dependent pathway. PMID: 23456484
- The HIF-1alpha/IL-8 signaling pathway plays a critical role in the protective effects of endothelial progenitor cells in the ischemic hind limb of diabetic mice. PMID: 23252631
- Changes in IL-8 expression level during development is related to its regulatory role in mouse mammary gland immunity. PMID: 23096912
- CagA may potentially interfere with TAK1 activity during NF-kB activation for IL-8 induction in early H. pylori infection PMID: 23409168
- These data suggest that IL-8 participates in the formation of cystic structures by Madin-Darby canine kidney cells in 3D culture and that HGF may stimulate tubulogenesis through the suppression of IL-8. PMID: 23485708
- ExoU activates NF-kappaB, stimulating IL-8 expression and secretion during P. aeruginosa infection PMID: 22848596
- Met signaling regulates the secretion of the pro-angiogenic chemokine interleukin-8/CXCL8 PMID: 22815748