Recombinant Mouse C-X-C Motif Chemokine 14 (CXCL14) Protein (His)

Beta LifeScience SKU/CAT #: BLC-08341P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Mouse C-X-C Motif Chemokine 14 (CXCL14) Protein (His)

Beta LifeScience SKU/CAT #: BLC-08341P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Mouse C-X-C Motif Chemokine 14 (CXCL14) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb Q9WUQ5
Target Symbol CXCL14
Synonyms Cxcl14; Bmac; Kec; Ks1; Mip2g; Scyb14C-X-C motif chemokine 14; B-cell and monocyte-activating chemokine; Chemokine BRAK; Kidney-expressed chemokine CXC; MIP-2G; Small-inducible cytokine B14
Species Mus musculus (Mouse)
Expression System E.coli
Tag N-6His
Target Protein Sequence SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIVTTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Expression Range 23-99aa
Protein Length Full Length of Mature Protein
Mol. Weight 13.4kDa
Research Area Others
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Chemotactic for CESS B-cells and THP-1 monocytes, but not T-cells.
Subcellular Location Secreted.
Protein Families Intercrine alpha (chemokine CxC) family
Database References

KEGG: mmu:57266

STRING: 10090.ENSMUSP00000021970

UniGene: PMID: 28359053

  • CXCL14 Tg mice showed a suppressed rate of carcinogenesis, decreased tumour volume, and reduced pulmonary metastasis, as well as an increased survival rate of mice following tumour cell injection. PMID: 25765541
  • CXCL14 does not seem to play a pivotal role during influenza and Escherichia coli infections of the lung. PMID: 25313607
  • CXCL14 was able to promote bone metastasis through enhancement of cancer cell tropism to the bone and/or recruitment of bone marrow cells around metastatic cancer cells. PMID: 24534874
  • In conclusion, our results suggested the important function of Cxcl14 in uNK cells and the proper level of Cxcl14 protein were required to recruit NK cells to pregnant uterus. PMID: 23688424
  • the transient expression of CXCL14 by Purkinje cells in the developing cerebellum, suggesting that it must be involved in the postnatal maturation of the cerebellum PMID: 22843118
  • CXCL14 may play an important role in central nervous system regulation of feeding behavior PMID: 20428232
  • Study identifies CXCL14 as a novel marker of tendon connective tissue. PMID: 21038449
  • Murine CXCL14 is dispensable for the homeostatic recruitment of antigen-presenting cells toward the periphery and for LC functionality. PMID: 17130243
  • CXCL14 is a critical chemoattractant of white adipose tissue macrophages and a novel regulator of glucose metabolism that functions mainly in skeletal muscle. PMID: 17724031
  • These results suggest that CXCL14 plays a causal role in high-fat diet-induced obesity. PMID: 17971304
  • Data suggest that despite the structural homology and similarity in tissue distribution of human and murine CXCL14, distinct differences point to diverse, species-specific needs for CXCL14 in epithelial immunity. PMID: 18809336
  • findings demonstrate that early overexpression of PMP22 in a mouse model of Charcot-Marie-Tooth disease type 1A results in a strong up-regulation of CXCL14 which seems to play a novel regulatory role in Schwann cell differentiation PMID: 19111616
  • CXCL14 is an important paracrine/autocrine modulator regulating trophoblast outgrowth at the maternal-fetal interface during the process of pregnancy establishment. PMID: 19626669
  • These data indicate the possibility that BRAK expression inhibits tumor cell establishment by regulating interactions between tumor stem cells and NK cells and/or suppressing formation of tumor microvessels. PMID: 19887729
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed