Recombinant Mouse C-X-C Motif Chemokine 10 (CXCL10) Protein (GST)

Name: Recombinant Mouse C-X-C Motif Chemokine 10 (CXCL10) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-07963P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Buy cytokines, chemokines, and growth factors for research online, Chemokines and receptors – essential regulators of immune response, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse C-X-C Motif Chemokine 10 (CXCL10) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P17515
Target Symbol	CXCL10
Synonyms	Cxcl10; Crg2; Ifi10; Inp10; Scyb10C-X-C motif chemokine 10; 10 kDa interferon gamma-induced protein; Gamma-IP10; IP-10; C7; Interferon-gamma induced protein CRG-2; Small-inducible cytokine B10
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
Expression Range	22-98aa
Protein Length	Full Length of Mature Protein
Mol. Weight	35.7kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Pro-inflammatory cytokine that is involved in a wide variety of processes such as chemotaxis, differentiation, and activation of peripheral immune cells, regulation of cell growth, apoptosis and modulation of angiostatic effects. Plays thereby an important role during viral infections by stimulating the activation and migration of immune cells to the infected sites. Mechanistically, binding of CXCL10 to the CXCR3 receptor activates G protein-mediated signaling and results in downstream activation of phospholipase C-dependent pathway, an increase in intracellular calcium production and actin reorganization. In turn, recruitment of activated Th1 lymphocytes occurs at sites of inflammation. Activation of the CXCL10/CXCR3 axis plays also an important role in neurons in response to brain injury for activating microglia, the resident macrophage population of the central nervous system, and directing them to the lesion site. This recruitment is an essential element for neuronal reorganization.
Subcellular Location	Secreted.
Protein Families	Intercrine alpha (chemokine CxC) family
Database References	KEGG: mmu:15945 STRING: 10090.ENSMUSP00000047646 UniGene: PMID: 30118441 CXCL10, not CXCL9 or CXCL11, induced IL-9 expression in the liver tissue. PMID: 29860220 in vivo experiments show that the CXCL10/CXC chemokine receptor family 3 axis prevents the recruitment of macrophages, reduces inflammation, and halts the progression of the disease; the increased production of IL-1beta highlights the autoinflammatory nature of congenital hepatic fibrosis and may open novel therapeutic avenues PMID: 29140564 CXCL10 and blood-brain barrier permeability enhancement in rabies virus infection PMID: 26895109 Study shows that circulating interferon- that binds to receptors on brain endothelial cells and induces Cxcl10, is a central link in the signaling chain eliciting inflammation-induced aversion. PMID: 28864260 The knockout of either CXCL10 or TNF-alpha reduced germ cell apoptosis in the co-cultures of germ cells and Sertoli cells in response to MuV infection. Local injection of MuV into the testes of mice confirmed the involvement of CXCL10 in germ cell apoptosis in vivo. PMID: 29072682 CXCL10 has strong inhibitory effects on neovascularization, whereas MMP13 is required for neovascularization in C. albicans-infected corneas. PMID: 28623423 Results suggest that CXCL10(-/-) mice are protected against diet-induced nonalcoholic steatohepatitis (NASH), in an obesity-independent manner. PMID: 27349927 In conclusion, upregulated CXCL10 in steatohepatitis impairs autophagic flux by reducing autolysosome formation, thereby inhibiting autophagic protein degradation and the accumulation of ubiquitinated proteins, leading to the development of steatohepatitis. PMID: 28824718 These findings highlight the importance of CXCL10 signaling in the pathogenesis of rheumatoid arthritis and provide previously unidentified details of the mechanisms by which CXCL10 promotes the development of arthritis. PMID: 28724396 Study revealed that CXCL10 evoked an ionic current mainly carried by Cl(-) channels, suggests that Cl(-) channels are likely key molecular candidates responsible for the CXCL10-evoked neuronal activation and itch-like behaviors in a murine model of allergic contact dermatitis induced by the antigen squaric acid dibutylester. Cl(-) channels may emerge as a promising drug target for the treatment of allergic itch. PMID: 28446581 Collectively, these results suggest that the CXCL10/CXCR3-mediated NF-kappaB signaling pathway plays a role in the control of autonomous regulation of CXCL10 and malignant tumor properties in breast cancer 4T1 cells. PMID: 28209986 In lipotoxic hepatocytes, MLK3 activates a MAPK signaling cascade, resulting in the activating phosphorylation of STAT1, and CXCL10 transcriptional upregulation. PMID: 28262979 These findings elucidate an NFAT-MAPK signaling paradigm for induction of isletokine expression in beta-cells and reveal IP-10 as a primary therapeutic target to prevent beta-cell-induced inflammatory loss of graft function after islet cell transplantation. PMID: 28855240 A novel function of CXCL10 in mediating monocyte production of proinflammatory cytokines in inflammatory bowel diseases has been described. PMID: 28899907 CXCL10 chemokine levels correlate negatively with gremlin-1 levels in mouse and human lung. PMID: 27428020 Increased CXCL10 expression led to decreased tumour burden and malignant ascites accumulation in the ID8 syngeneic murine model of HGSC. PMID: 28318643 CXCL10 plays in the pathogenesis of recurrent Herpetic stromal keratitis, and that CXCL9 displays its importance when CXCL10 is absent. PMID: 28282568 PERK and IRE1alpha/XBP1 in the unfolded protein response differentially regulate the expression of CXCL10 and CCL2 likely through modulation of ER stress-induced NF-kappaB RelA and STAT3 activation. PMID: 28065589 CXCL10 might influence the cellular composition locally in the islet graft, thereby playing a role in the autoimmune destruction. CXCL10 might therefore constitute a potential therapeutic target to prolong islet graft survival PMID: 27797910 Data provide first evidence for a link between oncogenic JAK2V617F signaling and cell intrinsic induction of CXCL10 induced by activated NFkB signaling. PMID: 28233092 Donor interleukin-22 and host type I interferon signaling pathway participate in intestinal graft-versus-host disease via STAT1 activation and CXCL10. PMID: 26153763 The results suggested that astrocytes contribute to Cerebral Malaria pathogenesis by producing CXCL10 in response to IFN-gamma and LT-alpha. PMID: 26687629 MiR-15a contributes abnormal immune response in myasthenia gravis by targeting CXCL10 PMID: 26845678 During hepatocyte lipotoxicity, activated MLK3 induces the release of CXCL10-bearing vesicles from hepatocytes, which are chemotactic for macrophages. PMID: 26406121 Neutrophils and inflammatory monocytes were identified as the main cellular sources of CXCL10 responsible for the induction of these processes PMID: 26718341 IP-10-treated mice exhibited reduced alkali-induced CrNV through decreasing intracorneal VEGF and bFGF expression, and inhibiting endothelial cell proliferation and tube formation. PMID: 25309995 Studied whether CXCL10 can inhibit the growth of cervical cancer; results show CXCL10 could reduce the level of HPV E6 and E7 in cervical cancer cells; in vivo study showed that CXCL10 could inhibit the growth of tumor in the immunodeficiency mice. PMID: 19257857 hepatic expression of the inflammatory CXC chemokine ligands (CXCL)9 and CXCL10 strongly increased whereas homeostatic CXCL12 significantly decreased. PMID: 26052942 The mesangial cell apoptosis observed in this mesangial proliferative glomerulonephritis model was related to CXCL10 expression induced by Mxi1 inactivation. PMID: 25683914 CXCL10 plays a pivotal role in the pathogenesis of experimental steatohepatitis. PMID: 25048951 The chemokines monocyte chemotactic protein 1 (MCP1), MIP1alpha, MIP1beta, interferon gamma-induced protein 10 (IP-10), and eotaxin were induced in Saa1 TG mice. PMID: 25847238 tumours are characterized by expression of inflammatory chemokines (CCL2, CCL5, CCL7, CCL8, CCL12, CXCL9, CXCL10 and CX3CL1), reflected by an enrichment of activated Foxp3(-) and Foxp3(+) T cells PMID: 25495686 These findings have implications for the role of CXCL10 as an important mediator during the initiation of neuroinflammatory processes associated with oligodendrocyte pathology. PMID: 25725102 We demonstrated the overexpression of genes coding for CXCL10 in murine astrocytes infected with Theiler's murine encephalomyelitis virus PMID: 25052192 Data show that testosterone treatment of female mice significantly reduced the expression of interleukin 17A (IL-17A), chemokines CXCL-9 and CXCL-10 within the liver. PMID: 25672751 Data indicate that C-X-C motif chemokine 10 (CXCL10) expression was increased in the inflammation of C protein-induced myositis (CIM) model and its blockade suppressed inflammation in muscle. PMID: 24939012 In rabies, CXCL10 initiates the cascade leading to activation of microglia/astrocytes, infiltration of inflammatory cells, expression of chemokines/cytokines, reduction of tight junction proteins expression, and blood-brain barrier permeability increase. PMID: 25339777 IP-10 levels were measured to test epithelial secretion in cytic fibrosis. PMID: 23977293 This study demonistrated that astroglial CXCL10 enhances spinal cord perivascular CD4+ lymphocyte accumulation and acute spinal cord demyelination in MOG peptide experimental autoimmune encephalomyelitis. PMID: 24924222 data indicate that epithelium-expressed CXCL10 plays a critical role in fungal clearance and that CXCR3-expressing NK cells contribute to CA eradication in mouse corneas. PMID: 24965580 WT1 regulates the expression levels of Cxcl10 and Ccl5 in epicardial cells directly and indirectly through increasing the levels of IRF7. PMID: 23900076 we found that IRF1 was essential for IL-1-induced expression of the chemokines CXCL10 and CCL5 PMID: 24464131 Bone marrow-derived CXCL10 and tissue-derived CXCL10 play a critical role in accelerating perfusion recovery after arterial occlusion in mice probably by promoting vascular smooth muscle cell recruitment and maturation of pre-existing anastomoses. PMID: 24407030 We report in this article that CXCL10 plays a role in CD8+ T cell priming PMID: 23940275 Hypersensitivity of Usp18 knockout in mammary epithelial cells to IFN-gamma enhances Cxcl10 expression and protects against mammary tumour progression. PMID: 23681607 Endogenous CXCL10 contributes to recruit the primary neutrophil influx and to affect the expression of cytokines, chemokines, and angiogenic factors as well as to reduce the viral titer and herpes stromal keratitis severity. PMID: 23720717 Enterovirus 71 (EV71) infection boosts IP-10 expression to increase gamma interferon and gamma interferon (Mig) levels, infiltration of CD8 T cells, virus clearance in tissues and the survival of mice. PMID: 23288420 CXCL10 is directly involved in the generation of a parasite specific CD8+ T cell-mediated immune response. PMID: 23144947 This study demonstrates that central nervous system-expressed CXCR3 ligand CXCL10 is the critical chemokine regulating antibody-secreting cell accumulation during coronavirus-induced encephalomyelitis. PMID: 23302888

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.